BQ623050

Overview
NameBQ623050
Unique NameBQ623050
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length680
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Match: SRK2E_ARATH (Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.546e-35
Identity = 79/115 (68.70%), Postives = 84/115 (73.04%), Query Frame = 2
Query:  131 PECRHLISRIFVADPAMRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQCLNGSL-XXXXXXXXXXXXXXXXXXXSSGEIVYAM 472
            PECRHLISRIFVADPA RISIPEIRNHEWFLKNLPADL+ DNT   QF+E DQP QSI+EIMQIIAEAT+P AGTQ+LN  L GSL                    SSGEIVYAM
Sbjct:  248 PECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFDESDQPGQSIEEIMQIIAEATVPPAGTQNLNHYLTGSLDIDDDMEEDLESDLDDLDIDSSGEIVYAM 362          
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Match: SAPKA_ORYSJ (Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.258e-32
Identity = 72/114 (63.16%), Postives = 84/114 (73.68%), Query Frame = 2
Query:  131 PECRHLISRIFVADPAMRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQCLNGSLXXXXXXXXXXXXXXXXXXXSSGEIVYAM 472
            PECR LI+RIFVA+PA RISIPEIRNH WFLKNLPADL+ D+  ++Q+EEP+QPMQS+DEIMQI+AEATIPAAG+  +NQ LN  L                   SSGEIVYAM
Sbjct:  250 PECRDLIARIFVANPATRISIPEIRNHPWFLKNLPADLMDDSKMSSQYEEPEQPMQSMDEIMQILAEATIPAAGSGGINQFLNDGL-DLDDDMEDLDSDPDLDVESSGEIVYAM 362          
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Match: SAPK9_ORYSJ (Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.542e-30
Identity = 67/114 (58.77%), Postives = 82/114 (71.93%), Query Frame = 2
Query:  131 PECRHLISRIFVADPAMRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQCLNGSLXXXXXXXXXXXXXXXXXXXSSGEIVYAM 472
            PECR LI+RIFV +PA RI++PEI+NH WF+KN+PADL+ D   +NQ+EEPDQPMQ+++EIMQI+AEATIPAAGT  +NQ L  SL                   SSGEIVYAM
Sbjct:  249 PECRDLITRIFVGNPASRITMPEIKNHPWFMKNIPADLMDDGMVSNQYEEPDQPMQNMNEIMQILAEATIPAAGTSGINQFLTDSL-DLDDDMEDMDSDLDLDIESSGEIVYAM 361          
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Match: SRK2I_ARATH (Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.214e-28
Identity = 65/114 (57.02%), Postives = 79/114 (69.30%), Query Frame = 2
Query:  131 PECRHLISRIFVADPAMRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQCLNGSLXXXXXXXXXXXXXXXXXXXSSGEIVYAM 472
            PEC HLISRIFVADPA RISIPEI+ H WFLKNLPADL+ ++ T +QF+EP+QPMQS+D IMQII+EATIPA   + L+  +  +L                   SSGEIVYA+
Sbjct:  249 PECCHLISRIFVADPATRISIPEIKTHSWFLKNLPADLMNESNTGSQFQEPEQPMQSLDTIMQIISEATIPAVRNRCLDDFMTDNL-DLDDDMDDFDSESEIDIDSSGEIVYAL 361          
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Match: SAPK8_ORYSJ (Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.198e-28
Identity = 65/114 (57.02%), Postives = 82/114 (71.93%), Query Frame = 2
Query:  131 PECRHLISRIFVADPAMRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQCLNGSLXXXXXXXXXXXXXXXXXXXSSGEIVYAM 472
            PECRHLISRIFV DP++RI+IPEIR+H WFLKNLPADL+ D++ ++Q+EEPDQPMQ++D+IMQI+ EATIP A ++ +N  L   L                   SSGEIVYAM
Sbjct:  260 PECRHLISRIFVGDPSLRITIPEIRSHGWFLKNLPADLMDDDSMSSQYEEPDQPMQTMDQIMQILTEATIPPACSR-INHILTDGL-DLDDDMDDLDSDSDIDVDSSGEIVYAM 371          
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Match: SRK2D_ARATH (Serine/threonine-protein kinase SRK2D OS=Arabidopsis thaliana GN=SRK2D PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.008e-26
Identity = 62/114 (54.39%), Postives = 77/114 (67.54%), Query Frame = 2
Query:  131 PECRHLISRIFVADPAMRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQCLNGSLXXXXXXXXXXXXXXXXXXXSSGEIVYAM 472
            PECRHLISRIFVADPA RI+IPEI + +WFLKNLP DL+ +N   +QF+EP+QPMQS+D IMQII+EATIP    + L+  +  +L                   SSGEIVYA+
Sbjct:  250 PECRHLISRIFVADPATRITIPEITSDKWFLKNLPGDLMDENRMGSQFQEPEQPMQSLDTIMQIISEATIPTVRNRCLDDFMADNL-DLDDDMDDFDSESEIDVDSSGEIVYAL 362          
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Match: SAPK2_ORYSJ (Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.686e-16
Identity = 40/79 (50.63%), Postives = 54/79 (68.35%), Query Frame = 2
Query:  134 ECRHLISRIFVADPAMRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQ 370
            ECRHL+SRIFVA+P  RI+IPEI+NH WFLKNLP ++  +   + Q  + + P Q ++EIM II EA  P  G++   Q
Sbjct:  232 ECRHLLSRIFVANPEQRITIPEIKNHPWFLKNLPIEMTDEYQMSVQMNDINTPSQGLEEIMAIIQEARKPGDGSKFSGQ 310          
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Match: SAPK2_ORYSI (Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 3.686e-16
Identity = 40/79 (50.63%), Postives = 54/79 (68.35%), Query Frame = 2
Query:  134 ECRHLISRIFVADPAMRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQ 370
            ECRHL+SRIFVA+P  RI+IPEI+NH WFLKNLP ++  +   + Q  + + P Q ++EIM II EA  P  G++   Q
Sbjct:  232 ECRHLLSRIFVANPEQRITIPEIKNHPWFLKNLPIEMTDEYQMSVQMNDINTPSQGLEEIMAIIQEARKPGDGSKFSGQ 310          
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Match: SAPK1_ORYSJ (Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.323e-15
Identity = 36/70 (51.43%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  134 ECRHLISRIFVADPAMRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIP 343
            +CRHL+SRIFV +P  RI+IPEI+NH WFLKNLP ++  +   + Q  + + P QS++E+M II EA  P
Sbjct:  232 DCRHLLSRIFVGNPEQRITIPEIKNHPWFLKNLPIEMTDEYQRSMQLADMNTPSQSLEEVMAIIQEARKP 301          
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Match: SAPK3_ORYSJ (Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.311e-13
Identity = 34/70 (48.57%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  134 ECRHLISRIFVADPAMRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIP 343
            +CR L+S+IFVADP+ RI+IPEI+ H WFLKNLP ++      + +  +   P Q+++EIM+II EA +P
Sbjct:  233 DCRRLLSQIFVADPSKRITIPEIKKHTWFLKNLPKEISEREKADYKDTDAAPPTQAVEEIMRIIQEAKVP 302          
The following BLAST results are available for this feature:
BLAST of BQ623050 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
SRK2E_ARATH3.546e-3568.70Serine/threonine-protein kinase SRK2E OS=Arabidops... [more]
SAPKA_ORYSJ6.258e-3263.16Serine/threonine-protein kinase SAPK10 OS=Oryza sa... [more]
SAPK9_ORYSJ1.542e-3058.77Serine/threonine-protein kinase SAPK9 OS=Oryza sat... [more]
SRK2I_ARATH3.214e-2857.02Serine/threonine-protein kinase SRK2I OS=Arabidops... [more]
SAPK8_ORYSJ4.198e-2857.02Serine/threonine-protein kinase SAPK8 OS=Oryza sat... [more]
SRK2D_ARATH3.008e-2654.39Serine/threonine-protein kinase SRK2D OS=Arabidops... [more]
SAPK2_ORYSJ3.686e-1650.63Serine/threonine-protein kinase SAPK2 OS=Oryza sat... [more]
SAPK2_ORYSI3.686e-1650.63Serine/threonine-protein kinase SAPK2 OS=Oryza sat... [more]
SAPK1_ORYSJ5.323e-1551.43Serine/threonine-protein kinase SAPK1 OS=Oryza sat... [more]
SAPK3_ORYSJ1.311e-1348.57Serine/threonine-protein kinase SAPK3 OS=Oryza sat... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00141 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00141 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623050 ID=BQ623050|Name=BQ623050|organism=Citrus sinensis|type=EST|length=680bp
CGTGGTACCTTCATCTATTTTCTATTATGAACAATTGAACATGACTGTAG
CTAATATCGAACTGTGCAATAGAGCATGAGCAGAGACTGAAGCCAAACCT
TCTTCCCTCTGGTCTCACACTGTAGGTCCTCCTGAGTGCCGCCATCTGAT
CTCTAGGATTTTCGTAGCTGACCCTGCAATGAGGATATCCATACCCGAGA
TCAGAAACCACGAATGGTTTTTGAAGAACCTTCCGGCAGATCTTGTGGTG
GATAACACAACAAACAATCAGTTTGAAGAACCAGATCAGCCTATGCAAAG
CATTGACGAAATCATGCAGATAATTGCTGAAGCCACCATACCTGCTGCTG
GTACCCAGAGCCTCAACCAGTGTTTGAATGGTAGTCTTGACATTGATGAT
GAAATGGACGAAGACATAGACACTGATCCTGATCTTGACATTGATAGCAG
CGGGGAGATTGTATATGCTATGTGATTGTCTTAAAGCTTGTTGAACCGGG
GGAGTTCAACGGTCCATTTGTTTACGGGATTTGGCTATTTAGGTGTGAAG
AATTAAAGAAACCTTTAACTCTCTGTTTGCAGTGGAGGATTATACATGTG
TTCTGTGTCGAGCCACTTTTTAAGTGGCATATATAATATACGTACTGGAA
TTTACTCTTCTGGTATACGGGGGATGTAAT
back to top