BQ623052

Overview
NameBQ623052
Unique NameBQ623052
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length634
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623052 vs. ExPASy Swiss-Prot
Match: TT12_ARATH (Protein TRANSPARENT TESTA 12 OS=Arabidopsis thaliana GN=TT12 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.342e-30
Identity = 68/191 (35.60%), Postives = 108/191 (56.54%), Query Frame = 3
Query:   15 ATIMLPVFIFGTPIMNLLGQQKDIAETGGVISLWLIPFVYNFVFSLTIQMFLQAQLKNMIIGWLSTASFLLHVLMSWIFVSELDLGIAGAMGSLNISAWLNIIGLFVYIFCGW-CPDTWKGFTNAAFTDILPVIKLSISSGVMICLELWYNSILVLLAGYMKNATVAISAFSICLNGSAFQLMIFLGFLGA 584
            A  +  ++ +  PI+  +GQ   IA  G + +  +IP +Y F  +  +Q FLQAQ     + ++S   FLLH L++W+  + LD G+ GA   L+ S WL +    +YI     C +TW GF+  AF  I P  KL+++S VM+CLE+WYN  LV+++G + N T+++ A SIC+    + +   LG   A
Sbjct:  144 AVFLTFLYWYSGPILKTMGQSVAIAHEGQIFARGMIPQIYAFALACPMQRFLQAQNIVNPLAYMSLGVFLLHTLLTWLVTNVLDFGLLGAALILSFSWWLLVAVNGMYILMSPNCKETWTGFSTRAFRGIWPYFKLTVASAVMLCLEIWYNQGLVIISGLLSNPTISLDAISICMYYLNWDMQFMLGLSAA 334          
The following BLAST results are available for this feature:
BLAST of BQ623052 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
TT12_ARATH1.342e-3035.60Protein TRANSPARENT TESTA 12 OS=Arabidopsis thalia... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00143 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00143 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623052 ID=BQ623052|Name=BQ623052|organism=Citrus sinensis|type=EST|length=634bp
TTGATTGTGTAACTGCTACAATAATGCTCCCCGTCTTCATCTTTGGAACA
CCGATCATGAATCTGCTTGGCCAGCAAAAGGATATAGCAGAAACAGGGGG
GGTGATTTCTCTGTGGTTGATTCCCTTTGTTTATAACTTCGTCTTCTCCT
TGACAATCCAAATGTTCTTACAAGCACAGCTCAAGAACATGATTATCGGG
TGGCTATCTACTGCTTCTTTCCTGCTTCACGTGCTTATGTCCTGGATCTT
TGTGAGTGAACTTGACTTAGGTATTGCTGGTGCAATGGGCTCATTAAACA
TTTCTGCGTGGCTAAATATCATTGGATTGTTTGTTTACATCTTCTGTGGT
TGGTGCCCTGATACTTGGAAAGGTTTCACCAACGCTGCCTTTACTGACAT
TCTTCCTGTAATAAAGCTGTCGATATCCTCCGGGGTCATGATTTGCTTGG
AGCTCTGGTACAATTCCATTCTAGTCTTATTGGCTGGGTACATGAAAAAT
GCAACCGTTGCCATATCTGCTTTCTCTATTTGCCTCAATGGCAGTGCATT
TCAATTAATGATCTTCCTTGGCTTCCTTGGTGCCTATGCGTGCCAGTGTC
GAATGAACTCGGGAGAGGAAATGCGAAAGCCACA
back to top