BQ623055

Overview
NameBQ623055
Unique NameBQ623055
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length715
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Match: M2K2_ARATH (Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2)

HSP 1 Score: 211.075 bits (536), Expect = 6.212e-63
Identity = 104/154 (67.53%), Postives = 121/154 (78.57%), Query Frame = 2
Query:  209 FMDGDLLVNKDGVRIVSQTETEAPPPIKPSDNQLNLEDIDTXXXXXXXXXXXXQLVQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLDLHHE 670
            F DGDL VNKDGVRI+SQ E E   PIKP+D+QL+L D+D             QLVQHKWTGQFFALKVIQ+N++E+ R+ IAQELKINQSSQCP +V  YQSFY NGAIS+ILEYMDGGSLADFLK VK IP+ YL+AI  QVL+GL+ LHH+
Sbjct:   32 FKDGDLRVNKDGVRIISQLEPEVLSPIKPADDQLSLSDLDMVKVIGKGSSGVVQLVQHKWTGQFFALKVIQLNIDEAIRKAIAQELKINQSSQCPNLVTSYQSFYDNGAISLILEYMDGGSLADFLKSVKAIPDSYLSAIFRQVLQGLIYLHHD 185          

HSP 2 Score: 38.5058 bits (88), Expect = 6.212e-63
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 1
Query:  109 MKKGGLNPNVKLKLSLPSSEEASFTKFLTKSGT 207
            MKKGG + N  LKL++P + E S TKFLT+SGT
Sbjct:    1 MKKGGFSNN--LKLAIPVAGEQSITKFLTQSGT 31          

HSP 3 Score: 33.8834 bits (76), Expect = 6.212e-63
Identity = 15/24 (62.50%), Postives = 19/24 (79.17%), Query Frame = 1
Query:  643 QGVVGSSS*KHIIHRDLKPSNLVI 714
            QG++     +HIIHRDLKPSNL+I
Sbjct:  177 QGLIYLHHDRHIIHRDLKPSNLLI 200          
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Match: M2K1_ARATH (Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 5.675e-53
Identity = 96/154 (62.34%), Postives = 116/154 (75.32%), Query Frame = 2
Query:  209 FMDGDLLVNKDGVRIVSQTETEAPPPIKPSDNQLNLEDIDTXXXXXXXXXXXXQLVQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLDLHHE 670
            F DGDL VNKDG++ VS +E  APPPI+P DNQL+L D++             QLV+HK T QFFALKVIQ+N EES  R I+QEL+IN SSQCPY+V CYQSFY NG +SIILE+MDGGSLAD LKKV  +PE  L+AIC++VL+GL  +HHE
Sbjct:   30 FKDGDLRVNKDGIQTVSLSEPGAPPPIEPLDNQLSLADLEVIKVIGKGSSGNVQLVKHKLTQQFFALKVIQLNTEESTCRAISQELRINLSSQCPYLVSCYQSFYHNGLVSIILEFMDGGSLADLLKKVGKVPENMLSAICKRVLRGLCYIHHE 183          

HSP 2 Score: 29.261 bits (64), Expect = 5.675e-53
Identity = 12/15 (80.00%), Postives = 14/15 (93.33%), Query Frame = 1
Query:  670 KHIIHRDLKPSNLVI 714
            + IIHRDLKPSNL+I
Sbjct:  184 RRIIHRDLKPSNLLI 198          

HSP 3 Score: 26.5646 bits (57), Expect = 5.675e-53
Identity = 16/33 (48.48%), Postives = 21/33 (63.64%), Query Frame = 1
Query:  109 MKKGGLNPNVKLKLSLPSSEEASFTKFLTKSGT 207
            M +G L PN    + LP  E+ S +KFLT+SGT
Sbjct:    1 MNRGSLCPN---PICLPPLEQ-SISKFLTQSGT 29          
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Match: M2K6_ARATH (Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.740e-47
Identity = 85/155 (54.84%), Postives = 110/155 (70.97%), Query Frame = 2
Query:  209 FMDGDLLVNKDGVRIVSQTETEAPPPIKPSDNQLNLEDIDTXXXXXXXXXXXXQLVQHKWTGQFFALKVIQMNVEESARRQIAQELKINQ-SSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLDLHHE 670
            F DGD L+N+ G+R+ S  +       K  D ++  ED++T            QLV+HKW G+FFA+KVIQMN++E  R+QI QELKINQ SSQCP+VVVCY SFY NGA S++LEYMD GSLAD +++VKTI E YLA +C+QVL GL+ LH+E
Sbjct:   32 FHDGDFLLNQKGLRLTSDEKQSRQSDSKELDFEITAEDLETVKVIGKGSGGVVQLVRHKWVGKFFAMKVIQMNIQEEIRKQIVQELKINQASSQCPHVVVCYHSFYHNGAFSLVLEYMDRGSLADVIRQVKTILEPYLAVVCKQVLLGLVYLHNE 186          

HSP 2 Score: 31.5722 bits (70), Expect = 1.740e-47
Identity = 12/23 (52.17%), Postives = 19/23 (82.61%), Query Frame = 1
Query:  646 GVVGSSS*KHIIHRDLKPSNLVI 714
            G+V   + +H+IHRD+KPSNL++
Sbjct:  179 GLVYLHNERHVIHRDIKPSNLLV 201          

HSP 3 Score: 27.335 bits (59), Expect = 1.740e-47
Identity = 13/25 (52.00%), Postives = 19/25 (76.00%), Query Frame = 1
Query:  139 KLKLSLPSSEEASFTKFLTKSGTVH 213
            +LKLS+P+ +E+  + FLT SGT H
Sbjct:   10 QLKLSVPA-QESPISSFLTASGTFH 33          
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Match: M2K1_ORYSJ (Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MEK1 PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 9.570e-45
Identity = 78/156 (50.00%), Postives = 112/156 (71.79%), Query Frame = 2
Query:  209 FMDGDLLVNKDGVRIVSQTETEAPPP--IKPSDNQLNLEDIDTXXXXXXXXXXXXQLVQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLDLHHE 670
            F DG+L +N+ G++++S+   + P    +K  D QL+++D++             QLV+HKW G  +ALK IQMN++E+ R+QI QELKINQ++Q  ++V+C+QSFY NG I ++LEYMD GSLAD +K+VKTI E YLA +C+QVL+GLL LHHE
Sbjct:   31 FKDGELRLNQRGLQLISEETADEPQSTNLKVEDVQLSMDDLEMIQVIGKGSGGIVQLVRHKWVGTLYALKGIQMNIQEAVRKQIVQELKINQATQNAHIVLCHQSFYHNGVIYLVLEYMDRGSLADIIKQVKTILEPYLAVLCKQVLEGLLYLHHE 186          

HSP 2 Score: 30.8018 bits (68), Expect = 9.570e-45
Identity = 10/15 (66.67%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  670 KHIIHRDLKPSNLVI 714
            +H+IHRD+KPSNL++
Sbjct:  187 RHVIHRDIKPSNLLV 201          

HSP 3 Score: 28.8758 bits (63), Expect = 9.570e-45
Identity = 15/29 (51.72%), Postives = 20/29 (68.97%), Query Frame = 1
Query:  121 GLNPNVKLKLSLPSSEEASFTKFLTKSGT 207
            G  P+ +LKLS+P ++E    KFLT SGT
Sbjct:    3 GKKPHKELKLSVP-AQETPVDKFLTASGT 30          
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Match: MP2K1_DICDI (Dual specificity mitogen-activated protein kinase kinase 1 OS=Dictyostelium discoideum GN=mekA PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.167e-21
Identity = 46/101 (45.54%), Postives = 68/101 (67.33%), Query Frame = 2
Query:  368 QLVQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLDLHHE 670
            +L  H+ +G + ALKVI ++++E+ R+QI  ELK    +  PY+V  Y +FY+ G+I I LE+M+ GSL+D +KK  TIPE  L  I  QVL+GL+ LH +
Sbjct:  307 KLAYHETSGTYIALKVITLDIQENIRKQIILELKTLHKTSYPYIVSFYDAFYTEGSIFIALEFMELGSLSDIMKKTSTIPEPVLGKIAFQVLQGLVYLHRK 407          

HSP 2 Score: 30.0314 bits (66), Expect = 1.167e-21
Identity = 12/24 (50.00%), Postives = 18/24 (75.00%), Query Frame = 1
Query:  643 QGVVGSSS*KHIIHRDLKPSNLVI 714
            QG+V      H+IHRD+KPSN+++
Sbjct:  399 QGLVYLHRKLHLIHRDIKPSNILV 422          
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Match: MP2K2_CHICK (Dual specificity mitogen-activated protein kinase kinase 2 OS=Gallus gallus GN=MAP2K2 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.294e-18
Identity = 44/100 (44.00%), Postives = 63/100 (63.00%), Query Frame = 2
Query:  374 VQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLDLHHEN 673
            VQHK +G   A K+I + ++ + R QI +EL++      PY+V  Y +FYS+G ISI +E+MDGGSL   LK+ K IPEE L  +   VL+GL  L  ++
Sbjct:   87 VQHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKH 186          

HSP 2 Score: 25.409 bits (54), Expect = 5.294e-18
Identity = 10/16 (62.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  670 KH-IIHRDLKPSNLVI 714
            KH I+HRD+KPSN+++
Sbjct:  185 KHQIMHRDVKPSNILV 200          
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Match: MP2K2_HUMAN (Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens GN=MAP2K2 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.164e-17
Identity = 43/100 (43.00%), Postives = 63/100 (63.00%), Query Frame = 2
Query:  374 VQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLDLHHEN 673
            VQH+ +G   A K+I + ++ + R QI +EL++      PY+V  Y +FYS+G ISI +E+MDGGSL   LK+ K IPEE L  +   VL+GL  L  ++
Sbjct:   89 VQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKH 188          

HSP 2 Score: 25.409 bits (54), Expect = 1.164e-17
Identity = 10/16 (62.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  670 KH-IIHRDLKPSNLVI 714
            KH I+HRD+KPSN+++
Sbjct:  187 KHQIMHRDVKPSNILV 202          
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Match: MP2K2_CANFA (Dual specificity mitogen-activated protein kinase kinase 2 OS=Canis familiaris GN=MAP2K2 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.164e-17
Identity = 43/100 (43.00%), Postives = 63/100 (63.00%), Query Frame = 2
Query:  374 VQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLDLHHEN 673
            VQH+ +G   A K+I + ++ + R QI +EL++      PY+V  Y +FYS+G ISI +E+MDGGSL   LK+ K IPEE L  +   VL+GL  L  ++
Sbjct:   89 VQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKH 188          

HSP 2 Score: 25.409 bits (54), Expect = 1.164e-17
Identity = 10/16 (62.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  670 KH-IIHRDLKPSNLVI 714
            KH I+HRD+KPSN+++
Sbjct:  187 KHQIMHRDVKPSNILV 202          
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Match: MP2K2_CYPCA (Dual specificity mitogen-activated protein kinase kinase 2 OS=Cyprinus carpio GN=map2k2 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 5.618e-17
Identity = 46/128 (35.94%), Postives = 69/128 (53.91%), Query Frame = 2
Query:  290 KPSDNQLNLEDIDTXXXXXXXXXXXXQLVQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLDLHHEN 673
            K    +L  ED D               V+HK +    A K+I + ++ + R QI +EL++      PY+V  Y +FYS+G ISI +E+MDGGSL   LK+ + IPEE L  +   VL+GL+ L  ++
Sbjct:   58 KAQVGELKDEDFDPICELGAGNGGVVHKVRHKPSRLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGLVYLREKH 185          

HSP 2 Score: 25.409 bits (54), Expect = 5.618e-17
Identity = 10/16 (62.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  670 KH-IIHRDLKPSNLVI 714
            KH I+HRD+KPSN+++
Sbjct:  184 KHQIMHRDVKPSNILV 199          
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Match: MP2K1_SERCA (Dual specificity mitogen-activated protein kinase kinase 1 (Fragment) OS=Serinus canaria GN=MAP2K1 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.308e-17
Identity = 42/100 (42.00%), Postives = 61/100 (61.00%), Query Frame = 2
Query:  374 VQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLDLHHEN 673
            V HK +G   A K+I + ++ + R QI +EL++      PY+V  Y +FYS+G ISI +E+MDGGSL   LKK   IPE+ L  +   V+KGL  L  ++
Sbjct:   78 VSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKH 177          

HSP 2 Score: 25.409 bits (54), Expect = 7.308e-17
Identity = 10/16 (62.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  670 KH-IIHRDLKPSNLVI 714
            KH I+HRD+KPSN+++
Sbjct:  176 KHKIMHRDVKPSNILV 191          
The following BLAST results are available for this feature:
BLAST of BQ623055 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
M2K2_ARATH6.212e-6367.53Mitogen-activated protein kinase kinase 2 OS=Arabi... [more]
M2K1_ARATH5.675e-5362.34Mitogen-activated protein kinase kinase 1 OS=Arabi... [more]
M2K6_ARATH1.740e-4754.84Mitogen-activated protein kinase kinase 6 OS=Arabi... [more]
M2K1_ORYSJ9.570e-4550.00Mitogen-activated protein kinase kinase 1 OS=Oryza... [more]
MP2K1_DICDI1.167e-2145.54Dual specificity mitogen-activated protein kinase ... [more]
MP2K2_CHICK5.294e-1844.00Dual specificity mitogen-activated protein kinase ... [more]
MP2K2_HUMAN1.164e-1743.00Dual specificity mitogen-activated protein kinase ... [more]
MP2K2_CANFA1.164e-1743.00Dual specificity mitogen-activated protein kinase ... [more]
MP2K2_CYPCA5.618e-1735.94Dual specificity mitogen-activated protein kinase ... [more]
MP2K1_SERCA7.308e-1742.00Dual specificity mitogen-activated protein kinase ... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00146 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00146 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623055 ID=BQ623055|Name=BQ623055|organism=Citrus sinensis|type=EST|length=715bp
ACACACTTTTCGCATTCTAAAACCCTAGAGACTTGATTTTTCATCATCAA
AGACTCTGCAACGACGACTTCGCTTCAGAAGAATCATAATAGACACAAGA
GCCCGATCATGAAGAAGGGAGGCTTAAACCCTAACGTGAAGCTCAAGCTC
TCTCTCCCTTCTTCTGAGGAAGCCTCTTTCACCAAATTTCTGACCAAGAG
CGGTACTGTTCATGGACGGTGATCTGCTCGTTAACAAAGACGGAGTTCGG
ATTGTCTCCCAGACTGAAACTGAAGCTCCACCGCCGATTAAGCCATCTGA
CAACCAGTTGAATTTGGAAGATATAGACACAATTAAAGTTGTTGGAAAGG
GAAGTGGTGGAATTGTGCAATTGGTGCAACACAAATGGACTGGCCAGTTT
TTTGCTTTAAAGGTTATTCAAATGAATGTTGAGGAGTCTGCACGAAGGCA
GATTGCTCAGGAGTTGAAAATTAATCAATCATCTCAATGTCCGTATGTTG
TCGTTTGTTATCAATCTTTCTACAGTAATGGTGCCATTTCAATTATTTTG
GAGTACATGGATGGTGGGTCTCTAGCTGATTTTCTGAAAAAAGTTAAAAC
TATTCCAGAAGAGTATCTGGCTGCCATCTGTGAGCAGGTGCTCAAGGGGT
TGTTGGATCTTCATCATGAAAACACATTATCCATAGGGATTTAAAGCCTT
CTAATTTGGTGATAA
back to top