BQ623057

Overview
NameBQ623057
Unique NameBQ623057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length613
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10255 contig Csv1_Contig10255:244..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623057 vs. ExPASy Swiss-Prot
Match: PLZ12_LUPPO (Protein PPLZ12 OS=Lupinus polyphyllus GN=PPLZ12 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.390e-37
Identity = 77/143 (53.85%), Postives = 101/143 (70.63%), Query Frame = 1
Query:  181 LDLDATFEQKNDIAKAVEEELEKAMSHYGYEIVQTLIVDIEPDEHVKRAMNXXXXXXXXXXXXXXXXXXXXXLQIKRAEGEAESKYLAGLGIARQRQAIVDGLRDSVLAFSENVPGTSSKDVMDMVLVTQYFDTMKEIGASSK 609
            ++LD  FEQK ++AK+V EELEK M  YGY I   L+VDI PD+ V+RAMN                     LQ+KRAE EAE+KYL G+G+ARQRQAI DGLR+++L FS  V GTS+K+VMD++++TQYFDT+K++G SSK
Sbjct:    1 MNLDDLFEQKGEVAKSVLEELEKVMGEYGYNIEHILMVDIIPDDSVRRAMNEINAAQRMQLASLYKGEAEKILQVKRAEAEAEAKYLGGVGVARQRQAITDGLRENILNFSHKVEGTSAKEVMDLIMITQYFDTIKDLGNSSK 143          
The following BLAST results are available for this feature:
BLAST of BQ623057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PLZ12_LUPPO1.390e-3753.85Protein PPLZ12 OS=Lupinus polyphyllus GN=PPLZ12 PE... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00148 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00148 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623057 ID=BQ623057|Name=BQ623057|organism=Citrus sinensis|type=EST|length=613bp
GCAGTTGGATGTTCGATGTGAAAACAAAAACCAAGGACAATGTGTTTGTT
AATGTGGTTGCTTCCGTTCAATACCGAGCCTTGGCAGAGAAAGGCTTCAG
ATGCCTTTTATAAGCTCAGCAATACTAGATCGCAGATCCAAGCGTATGTC
TTTGATGTTATTAGGGCAAGTGTACCAAAGCTGGACCTGGATGCAACCTT
TGAGCAGAAGAACGACATAGCCAAAGCTGTGGAAGAGGAACTCGAAAAGG
CCATGTCTCATTATGGTTATGAGATAGTTCAGACTCTCATCGTAGATATT
GAACCAGATGAACATGTGAAGAGAGCAATGAATGAGATCAATGCAGCGGC
CAGATTGAGGCTGGCTGCAAATGAGAAAGCGGAAGCAGAGAAAATATTGC
AGATCAAGCGTGCTGAAGGAGAAGCAGAATCAAAGTATTTGGCAGGCCTT
GGTATTGCACGTCAGCGTCAGGCCATTGTTGATGGCCTGAGGGATAGCGT
GCTAGCCTTCTCTGAAAATGTACCTGGAACATCTTCAAAGGATGTCATGG
ACATGGTTCTGGTCACCCAGTATTTTGATACCATGAAGGAAATTGGTGCC
TCCTCAAAACTAA
back to top