BQ623087

Overview
NameBQ623087
Unique NameBQ623087
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length719
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8171 contig Csv1_Contig8171:173..891. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Match: VATA_CITUN (V-type proton ATPase catalytic subunit A OS=Citrus unshiu PE=2 SV=1)

HSP 1 Score: 477.248 bits (1227), Expect = 3.671e-134
Identity = 238/238 (100.00%), Postives = 238/238 (100.00%), Query Frame = 2
Query:    2 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 715
            VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR
Sbjct:  308 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 545          
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Match: VATA_PHAAU (V-type proton ATPase catalytic subunit A OS=Phaseolus aureus PE=1 SV=3)

HSP 1 Score: 474.552 bits (1220), Expect = 2.379e-133
Identity = 236/238 (99.16%), Postives = 237/238 (99.58%), Query Frame = 2
Query:    2 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 715
            VMKRTTLVANTSNMPVAAREASIYTGIT+AEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYER GKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR
Sbjct:  308 VMKRTTLVANTSNMPVAAREASIYTGITLAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERPGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 545          
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Match: VATA_ARATH (V-type proton ATPase catalytic subunit A OS=Arabidopsis thaliana GN=VHA-A PE=2 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 4.058e-133
Identity = 236/238 (99.16%), Postives = 237/238 (99.58%), Query Frame = 2
Query:    2 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 715
            VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPER GSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYE+FDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR
Sbjct:  308 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERNGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEKFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 545          
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Match: VATA_BRANA (V-type proton ATPase catalytic subunit A OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 1.305e-131
Identity = 234/238 (98.32%), Postives = 236/238 (99.16%), Query Frame = 2
Query:    2 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 715
            VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPER GSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYE+FD DFI+IRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR
Sbjct:  308 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERNGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEKFDSDFIDIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 545          
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Match: VATA_GOSHI (V-type proton ATPase catalytic subunit A OS=Gossypium hirsutum GN=CVA69.24 PE=2 SV=1)

HSP 1 Score: 468.003 bits (1203), Expect = 2.227e-131
Identity = 234/238 (98.32%), Postives = 236/238 (99.16%), Query Frame = 2
Query:    2 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 715
            VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYS ALESFYE+FDPDFI+IRTKAREVLQREDDLNEIVQLVGKDALAE DKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR
Sbjct:  308 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSGALESFYEKFDPDFISIRTKAREVLQREDDLNEIVQLVGKDALAETDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 545          
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Match: VATA_DAUCA (V-type proton ATPase catalytic subunit A OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 1.105e-130
Identity = 233/238 (97.90%), Postives = 235/238 (98.74%), Query Frame = 2
Query:    2 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 715
            VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPER GSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYE+FD DFI+IRTKAREVLQREDDLNEIVQLVGKDALAE DKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR
Sbjct:  308 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERNGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEKFDSDFIDIRTKAREVLQREDDLNEIVQLVGKDALAETDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 545          
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Match: VATA_MAIZE (V-type proton ATPase catalytic subunit A (Fragment) OS=Zea mays PE=2 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 4.200e-130
Identity = 231/238 (97.06%), Postives = 234/238 (98.32%), Query Frame = 2
Query:    2 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 715
            VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLG P+R GSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYS ALESFYE+FDPDFI+IRTKAREVLQREDDLNEIVQLVGKDALAE DKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR
Sbjct:  246 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGSPDRNGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSKALESFYEKFDPDFIDIRTKAREVLQREDDLNEIVQLVGKDALAESDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 483          
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Match: VATA_HORVU (V-type proton ATPase catalytic subunit A (Fragment) OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 8.757e-128
Identity = 225/238 (94.54%), Postives = 233/238 (97.90%), Query Frame = 2
Query:    2 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 715
            VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLA+RLASFYERAGKV+CLG P+RTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALE +YE+FDP FI++RTKAREVLQREDDLNEIVQLVGKDAL E DKITLETAKLLREDYLAQNAFTPYDK+CPFYKSVWMMR
Sbjct:  265 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLASRLASFYERAGKVQCLGSPDRTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALEGYYEKFDPGFIDMRTKAREVLQREDDLNEIVQLVGKDALGESDKITLETAKLLREDYLAQNAFTPYDKYCPFYKSVWMMR 502          
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Match: VATA_BETVU (V-type proton ATPase catalytic subunit A OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 452.21 bits (1162), Expect = 1.264e-126
Identity = 227/238 (95.38%), Postives = 231/238 (97.06%), Query Frame = 2
Query:    2 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 715
            VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADS SRWAEALREISGRLAEMPADSGYPAYLAARLASFYE AGKVKCLGGPER GSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYS ALESFYE+FD +FI+IRTKAREVLQREDDLNEIVQLVGKDALAE DKITL+TAKLLREDYLAQNAFT YDKFCPFYKSVWMMR
Sbjct:  308 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSGSRWAEALREISGRLAEMPADSGYPAYLAARLASFYEAAGKVKCLGGPERNGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSGALESFYEKFDSEFIDIRTKAREVLQREDDLNEIVQLVGKDALAETDKITLDTAKLLREDYLAQNAFTAYDKFCPFYKSVWMMR 545          
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Match: VATA2_ACEAT (V-type proton ATPase catalytic subunit A isoform 2 OS=Acetabularia acetabulum PE=2 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 3.451e-116
Identity = 205/238 (86.13%), Postives = 220/238 (92.44%), Query Frame = 2
Query:    2 VMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSTALESFYEQFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAEGDKITLETAKLLREDYLAQNAFTPYDKFCPFYKSVWMMR 715
            +MKRTTLVANTSNMPVAAREASIYTGIT++EYFRDMGYN +MMADSTSRWAEALREISGRLAEMPADSGYPAYL ARLASFYER+G+V C+G PER GSVTIVGAVSPPGGDFSDPVTSATL IVQVFWGLDKKLAQRKHFPSVNWLISYSKY  ALE FYE+FD DF++IR  AREVLQ+ED+LNEIVQLVGKDALAE DKI LETA  L+EDYLAQN+FT YDK+CPFYKSV MMR
Sbjct:  296 IMKRTTLVANTSNMPVAAREASIYTGITLSEYFRDMGYNFAMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERSGRVACIGSPEREGSVTIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYLNALEPFYEKFDNDFVDIRQVAREVLQKEDELNEIVQLVGKDALAESDKIILETADFLKEDYLAQNSFTKYDKYCPFYKSVGMMR 533          
The following BLAST results are available for this feature:
BLAST of BQ623087 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
VATA_CITUN3.671e-134100.00V-type proton ATPase catalytic subunit A OS=Citrus... [more]
VATA_PHAAU2.379e-13399.16V-type proton ATPase catalytic subunit A OS=Phaseo... [more]
VATA_ARATH4.058e-13399.16V-type proton ATPase catalytic subunit A OS=Arabid... [more]
VATA_BRANA1.305e-13198.32V-type proton ATPase catalytic subunit A OS=Brassi... [more]
VATA_GOSHI2.227e-13198.32V-type proton ATPase catalytic subunit A OS=Gossyp... [more]
VATA_DAUCA1.105e-13097.90V-type proton ATPase catalytic subunit A OS=Daucus... [more]
VATA_MAIZE4.200e-13097.06V-type proton ATPase catalytic subunit A (Fragment... [more]
VATA_HORVU8.757e-12894.54V-type proton ATPase catalytic subunit A (Fragment... [more]
VATA_BETVU1.264e-12695.38V-type proton ATPase catalytic subunit A OS=Beta v... [more]
VATA2_ACEAT3.451e-11686.13V-type proton ATPase catalytic subunit A isoform 2... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00178 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00178 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623087 ID=BQ623087|Name=BQ623087|organism=Citrus sinensis|type=EST|length=719bp
TGTCATGAAGCGTACAACACTTGTGGCCAACACTTCTAACATGCCTGTGG
CTGCTCGTGAGGCTTCGATTTATACAGGAATCACCATAGCTGAATATTTC
AGAGATATGGGGTACAATGTTAGCATGATGGCAGATTCAACTTCTCGTTG
GGCAGAAGCGTTGCGTGAAATTTCAGGACGGCTGGCAGAAATGCCTGCAG
ATAGTGGATATCCTGCTTACCTGGCTGCACGTTTGGCCTCATTTTATGAA
CGTGCTGGGAAAGTTAAATGTCTTGGTGGACCAGAACGTACTGGTAGTGT
CACAATTGTTGGTGCAGTTTCTCCTCCTGGAGGAGATTTCTCAGATCCTG
TAACATCTGCCACCCTCAGCATTGTGCAGGTCTTCTGGGGTCTGGATAAG
AAACTTGCGCAGAGAAAGCATTTTCCTTCTGTAAACTGGCTTATTTCTTA
CTCGAAGTATTCAACAGCATTAGAGTCTTTCTATGAGCAATTTGATCCGG
ATTTTATTAACATCAGGACAAAGGCTAGAGAGGTGCTGCAGAGAGAAGAT
GACCTGAATGAAATTGTGCAACTTGTCGGAAAGGATGCTTTGGCTGAAGG
AGATAAGATTACGCTAGAGACTGCTAAGCTTTTGAGGGAGGACTATCTTG
CTCAAAACGCATTTACTCCATATGACAAGTTCTGCCCTTTCTACAAGTCT
GTTTGGATGATGCGTACAT
back to top