BQ623092

Overview
NameBQ623092
Unique NameBQ623092
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length635
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11919 contig Csv1_Contig11919:551..1184. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Match: TPT_SPIOL (Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 5.374e-104
Identity = 158/174 (90.80%), Postives = 170/174 (97.70%), Query Frame = 1
Query:    1 VGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMGKFISDLFWVG 522
            VGLPKRAP+DSKLLKLLIPVAVCHA+GHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQF+LGQ +P+TLWLSLAPVVIGVSMASLTELSFNW GFISAMISN+SFTYRS+YSKKAMTDMDSTNIYAYISIIALFVC+PPAIIVEGPQL+KHG +DAI+KVG+ KFISDLFWVG
Sbjct:  151 VGLPKRAPMDSKLLKLLIPVAVCHAIGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFVLGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNVSFTYRSLYSKKAMTDMDSTNIYAYISIIALFVCLPPAIIVEGPQLMKHGFNDAIAKVGLTKFISDLFWVG 324          

HSP 2 Score: 75.0998 bits (183), Expect = 5.374e-104
Identity = 37/41 (90.24%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  512 FGWGMFYHLYNQLATNTLERGAPLTHAVGNGLKRVFVIGFS 634
            F  GMFYHLYNQLATNTLER APLTHAVGN LKRVFVIGFS
Sbjct:  321 FWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFS 361          
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Match: TPT1_BRAOB (Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 1.868e-101
Identity = 152/174 (87.36%), Postives = 169/174 (97.13%), Query Frame = 1
Query:    1 VGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMGKFISDLFWVG 522
            VGLPKRAP++S +LK+LIPVAVCHA+GHVTSNVSFAAVAVSFTHTIKALEPFFNA+ASQF+LGQ +P+TLWLSLAPVV+GV+MASLTELSFNW GFISAMISNISFTYRSI+SKKAMTDMDSTN+YAYISIIALFVC+PPAIIVEGPQL+KHG +DAI+KVGM KFISDLFWVG
Sbjct:  154 VGLPKRAPVNSDILKVLIPVAVCHAIGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFLLGQPIPITLWLSLAPVVLGVAMASLTELSFNWLGFISAMISNISFTYRSIFSKKAMTDMDSTNVYAYISIIALFVCLPPAIIVEGPQLLKHGFNDAIAKVGMTKFISDLFWVG 327          

HSP 2 Score: 75.0998 bits (183), Expect = 1.868e-101
Identity = 37/41 (90.24%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  512 FGWGMFYHLYNQLATNTLERGAPLTHAVGNGLKRVFVIGFS 634
            F  GMFYHLYNQLATNTLER APLTHAVGN LKRVFVIGFS
Sbjct:  324 FWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFS 364          
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Match: TPT_FLAPR (Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 2.437e-101
Identity = 157/174 (90.23%), Postives = 166/174 (95.40%), Query Frame = 1
Query:    1 VGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMGKFISDLFWVG 522
            VGLPKRAP+DS LLKLLIPVA CHALGHVTSNVSFAAVAVSFTHTIK+LEPFFNAAASQFILGQ +P+TLWLSLAPVVIGVSMASLTELSFNW GFISAMISNISFTYRSIYSKKAMTDMDSTN+YAYISII+L  CIPPAII+EGPQL+KHG SDAI+KVGM KFISDLFWVG
Sbjct:  155 VGLPKRAPMDSNLLKLLIPVAFCHALGHVTSNVSFAAVAVSFTHTIKSLEPFFNAAASQFILGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNLYAYISIISLLFCIPPAIILEGPQLLKHGFSDAIAKVGMTKFISDLFWVG 328          

HSP 2 Score: 72.7886 bits (177), Expect = 2.437e-101
Identity = 36/41 (87.80%), Postives = 36/41 (87.80%), Query Frame = 2
Query:  512 FGWGMFYHLYNQLATNTLERGAPLTHAVGNGLKRVFVIGFS 634
            F  GMFYHLYNQLA NTLER APLTHAVGN LKRVFVIGFS
Sbjct:  325 FWVGMFYHLYNQLAINTLERVAPLTHAVGNVLKRVFVIGFS 365          
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Match: TPT_PEA (Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 9.214e-101
Identity = 155/174 (89.08%), Postives = 165/174 (94.83%), Query Frame = 1
Query:    1 VGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMGKFISDLFWVG 522
            VGLPKRAPID  LLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHT+KALEPFFNAAASQFILGQ +P+TLWLSLAPVVIGVSMASLTELSFNW GFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIAL VCIPPA+I+EGP L+K G +DAI+KVG+ KF+SDLFWVG
Sbjct:  149 VGLPKRAPIDGNLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTVKALEPFFNAAASQFILGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALIVCIPPALIIEGPTLLKTGFNDAIAKVGLVKFVSDLFWVG 322          

HSP 2 Score: 73.9442 bits (180), Expect = 9.214e-101
Identity = 36/41 (87.80%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  512 FGWGMFYHLYNQLATNTLERGAPLTHAVGNGLKRVFVIGFS 634
            F  GMFYHLYNQ+ATNTLER APLTHAVGN LKRVFVIGFS
Sbjct:  319 FWVGMFYHLYNQVATNTLERVAPLTHAVGNVLKRVFVIGFS 359          
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Match: TPT_FLATR (Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 2.669e-100
Identity = 152/174 (87.36%), Postives = 164/174 (94.25%), Query Frame = 1
Query:    1 VGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMGKFISDLFWVG 522
            VGLPKRAP+DS +LKLLIPV  CHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQF+LGQ +P++LWLSLAPVVIGVSMASLTELSFNW GFISAMISNISFTYRSIYSKKAMTDMDSTN+YAYISIIAL  CIPPA++ EGPQL+KHG +DAI+KVGM KFISDLFWVG
Sbjct:  154 VGLPKRAPVDSNILKLLIPVGFCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFVLGQSIPISLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNLYAYISIIALLFCIPPAVLFEGPQLLKHGFNDAIAKVGMIKFISDLFWVG 327          

HSP 2 Score: 74.3294 bits (181), Expect = 2.669e-100
Identity = 36/41 (87.80%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  512 FGWGMFYHLYNQLATNTLERGAPLTHAVGNGLKRVFVIGFS 634
            F  GMFYHLYNQ+ATNTLER APLTHAVGN LKRVFVIGFS
Sbjct:  324 FWVGMFYHLYNQIATNTLERVAPLTHAVGNVLKRVFVIGFS 364          
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Match: TPT_SOLTU (Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 4.175e-98
Identity = 148/174 (85.06%), Postives = 161/174 (92.53%), Query Frame = 1
Query:    1 VGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMGKFISDLFWVG 522
            VGLPKRAPIDS  LKLL PVA CHALGHVTSNVSFAAV VSFTHT+KALEPFFNAAASQFILGQQ+PL LWLSLAPVV+GVSMASLTELSFNW GF SAMISNISFTYRSIYSKKAMTDMDSTN+YAYISIIAL  C+PPAI +EGPQL++HG +DAI+KVG+ KF++DLFWVG
Sbjct:  161 VGLPKRAPIDSTQLKLLTPVAFCHALGHVTSNVSFAAVRVSFTHTVKALEPFFNAAASQFILGQQIPLALWLSLAPVVLGVSMASLTELSFNWLGFTSAMISNISFTYRSIYSKKAMTDMDSTNVYAYISIIALIFCLPPAIFIEGPQLLQHGFNDAIAKVGLTKFVTDLFWVG 334          

HSP 2 Score: 73.9442 bits (180), Expect = 4.175e-98
Identity = 36/41 (87.80%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  512 FGWGMFYHLYNQLATNTLERGAPLTHAVGNGLKRVFVIGFS 634
            F  GMFYHLYNQ+ATNTLER APLTHAVGN LKRVFVIGFS
Sbjct:  331 FWVGMFYHLYNQVATNTLERVAPLTHAVGNVLKRVFVIGFS 371          
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Match: TPT_MAIZE (Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 5.004e-96
Identity = 146/174 (83.91%), Postives = 163/174 (93.68%), Query Frame = 1
Query:    1 VGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMGKFISDLFWVG 522
            VGLPKRAPI+  LLKLL PVA+CH +GH+TSNVSFAAVAVSF HTIKALEPFF+AAA+QFILGQQ+P +LWLSLAPVVIGVSMASLTELSFNWTGFI+AMISNISFTYRSIYSKKAMTDMDSTN+YAYISIIAL VCIPPA+I EGP+L++HG SDAI+KVG+ KF+SDLF VG
Sbjct:  157 VGLPKRAPINGTLLKLLFPVALCHGIGHITSNVSFAAVAVSFAHTIKALEPFFSAAATQFILGQQVPFSLWLSLAPVVIGVSMASLTELSFNWTGFINAMISNISFTYRSIYSKKAMTDMDSTNVYAYISIIALIVCIPPALIFEGPKLMQHGFSDAIAKVGLTKFVSDLFLVG 330          

HSP 2 Score: 72.7886 bits (177), Expect = 5.004e-96
Identity = 34/38 (89.47%), Postives = 36/38 (94.74%), Query Frame = 2
Query:  521 GMFYHLYNQLATNTLERGAPLTHAVGNGLKRVFVIGFS 634
            G+FYHLYNQ+ATNTLER APLTHAVGN LKRVFVIGFS
Sbjct:  330 GLFYHLYNQIATNTLERVAPLTHAVGNVLKRVFVIGFS 367          
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Match: GPT1_ARATH (Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 5.811e-42
Identity = 75/164 (45.73%), Postives = 109/164 (66.46%), Query Frame = 1
Query:    1 VGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAM--TDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVG 486
            VG+ +    D    K L PVAV H +GHV + VS + VAVSFTH IK+ EP F+   S+FILG+  P +++LSL P++ G ++++LTEL+FN  GF+ AMISN++F +R+I+SKK M    +   N YA +S+++L +  P AI VEGPQ+   G   A++ VG
Sbjct:  146 VGIVETPKTDFDFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFILGETFPTSVYLSLIPIIGGCALSALTELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQMWVDGWQTALATVG 309          

HSP 2 Score: 43.5134 bits (101), Expect = 5.811e-42
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 2
Query:  470 QFPKWAWASSFQIFFGWGMFYHLYNQLATNTLERGAPLTHAVGNGLKRVFVI 625
            QF  W  A S        +FYHLYNQ++  +L++ +PLT +VGN +KR+ VI
Sbjct:  311 QFVWWVVAQS--------VFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVI 354          
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Match: GPT2_ARATH (Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=GPT2 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.813e-40
Identity = 72/155 (46.45%), Postives = 107/155 (69.03%), Query Frame = 1
Query:   28 DSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAM--TDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVG 486
            D +  K L PVAV H +GHV + VS + VAVSFTH IK+ EP F+   S+F +G+  PL ++LSL P++ G ++A++TEL+FN TGF+ AMISN++F +R+I+SKK M    +   N YA +S+++L +  P +I VE PQ+   G  +A+S+VG
Sbjct:  155 DLEFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFFMGETFPLPVYLSLLPIIGGCALAAITELNFNITGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLVILTPFSIAVEVPQMWAAGWQNAVSQVG 309          

HSP 2 Score: 41.9726 bits (97), Expect = 1.813e-40
Identity = 17/34 (50.00%), Postives = 28/34 (82.35%), Query Frame = 2
Query:  524 MFYHLYNQLATNTLERGAPLTHAVGNGLKRVFVI 625
            +FYHLYNQ++  +L++ +PLT ++GN +KR+ VI
Sbjct:  321 VFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVI 354          
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Match: TPT2_BRAOB (Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.365e-32
Identity = 65/152 (42.76%), Postives = 101/152 (66.45%), Query Frame = 1
Query:    1 VGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWL--SLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMT----DMDSTNIYAYISIIALFVCIPPAIIVEG 438
            + L KR  I +  L  ++P+AV H LG++ +N+S   V+VSFTHTIKA+EPFF+   S   LG ++P T W+  S+ P+V GV++AS+TE+SFNW GF+SAM SN++   R++ SKK M      +D+  +++ I++++LF+  P     EG
Sbjct:  151 LNLYKRPKISAAQLAAILPLAVVHTLGNLFTNMSLGKVSVSFTHTIKAMEPFFSVVLSAMFLG-EVP-TPWVIGSIIPIVGGVALASVTEVSFNWAGFLSAMASNLTNQSRNVLSKKVMVKKDDSLDNITLFSIITLMSLFLMAPVTFFSEG 300          

HSP 2 Score: 36.1946 bits (82), Expect = 4.365e-32
Identity = 16/32 (50.00%), Postives = 23/32 (71.88%), Query Frame = 2
Query:  530 YHLYNQLATNTLERGAPLTHAVGNGLKRVFVI 625
            +H Y Q++   L R +P+TH+VGN +KRV VI
Sbjct:  329 FHAYQQVSYMILARVSPVTHSVGNCVKRVVVI 360          
The following BLAST results are available for this feature:
BLAST of BQ623092 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
TPT_SPIOL5.374e-10490.80Triose phosphate/phosphate translocator, chloropla... [more]
TPT1_BRAOB1.868e-10187.36Triose phosphate/phosphate translocator, chloropla... [more]
TPT_FLAPR2.437e-10190.23Triose phosphate/phosphate translocator, chloropla... [more]
TPT_PEA9.214e-10189.08Triose phosphate/phosphate translocator, chloropla... [more]
TPT_FLATR2.669e-10087.36Triose phosphate/phosphate translocator, chloropla... [more]
TPT_SOLTU4.175e-9885.06Triose phosphate/phosphate translocator, chloropla... [more]
TPT_MAIZE5.004e-9683.91Triose phosphate/phosphate translocator, chloropla... [more]
GPT1_ARATH5.811e-4245.73Glucose-6-phosphate/phosphate translocator 1, chlo... [more]
GPT2_ARATH1.813e-4046.45Glucose-6-phosphate/phosphate translocator 2, chlo... [more]
TPT2_BRAOB4.365e-3242.76Triose phosphate/phosphate translocator, non-green... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00183 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00183 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623092 ID=BQ623092|Name=BQ623092|organism=Citrus sinensis|type=EST|length=635bp
GTGGGCCTTCCCAAGCGAGCTCCTATTGATTCAAAACTCCTGAAGCTCTT
AATCCCTGTTGCTGTGTGTCATGCATTGGGCCATGTTACCAGCAACGTGT
CTTTTGCAGCAGTTGCTGTCTCCTTTACCCATACCATCAAAGCTCTTGAG
CCCTTCTTCAACGCTGCTGCTTCACAATTCATTCTAGGCCAACAGTTACC
TCTGACTCTGTGGCTGTCTCTTGCTCCTGTGGTTATTGGAGTGTCAATGG
CATCATTGACTGAGCTGTCGTTCAATTGGACGGGCTTCATTAGTGCTATG
ATTTCCAACATATCGTTTACTTACAGGAGTATCTACTCCAAGAAAGCCAT
GACTGATATGGACAGTACTAATATTTATGCCTATATTTCCATCATTGCGC
TCTTTGTCTGTATTCCACCAGCCATCATTGTTGAGGGACCTCAACTGATT
AAGCATGGCTTAAGTGATGCAATTTCCAAAGTGGGCATGGGCAAGTTCAT
TTCAGATCTTTTTTGGGTGGGGGATGTTTTACCACCTCTACAATCAGTTG
GCTACCAACACCTTGGAGAGGGGTGCACCTCTTACTCATGCAGTTGGCAA
TGGACTGAAACGTGTGTTTGTGATTGGGTTCTCAA
back to top