BQ623093

Overview
NameBQ623093
Unique NameBQ623093
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2181 contig Csv1_Contig2181:36..678. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Match: CP20A_ARATH (Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Arabidopsis thaliana GN=CYP20-1 PE=1 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 8.158e-79
Identity = 145/175 (82.86%), Postives = 153/175 (87.43%), Query Frame = 2
Query:  104 SSIQAKKSDQNLKEITNKVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSK 628
            S+IQAKKS +NLKEIT+KVYFDVEI GK AGRIVMGLFGK VPKT ENFRALCTGEKGIGK+GK LHYKGS+FHRIIPSFMLQ            ESIYGEKF DENFKLKHTGPG LSMANAG DTNGSQFFITTVTTSWLDGRHVVFGKV++GMDVVYKVEAEG Q+GTPKSK
Sbjct:   19 SAIQAKKSKENLKEITHKVYFDVEIDGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKALHYKGSSFHRIIPSFMLQGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGFLSMANAGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSK 193          
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Match: CP19D_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Arabidopsis thaliana GN=CYP19-4 PE=1 SV=2)

HSP 1 Score: 286.189 bits (731), Expect = 9.972e-77
Identity = 140/185 (75.68%), Postives = 158/185 (85.41%), Query Frame = 2
Query:   74 MGLLSCWPPFSSIQAKKSDQNLKEITNKVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSK 628
            +G L  +   +SIQAK   ++LKE+T+KVYFDVEI GK AGR+V+GLFGKAVPKTAENFRALCTGEKG+GKSGKPLHYKGS FHRIIPSFM+Q            ESIYG+KF DENFKLKHTGPG+LSMAN+G DTNGSQFFITTVTTSWLDGRHVVFGKV+ GMDVVYK+EAEG+Q+GTPKSK
Sbjct:    9 LGTLFLFGAIASIQAK---EDLKEVTHKVYFDVEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSK 190          
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Match: PPIB_DICDI (Peptidyl-prolyl cis-trans isomerase B OS=Dictyostelium discoideum GN=cypB PE=1 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.070e-62
Identity = 113/168 (67.26%), Postives = 133/168 (79.17%), Query Frame = 2
Query:  143 EITNKVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSKSSLQTA 646
            +ITNKV+FD+EI  KPAGRIV GL+GK VPKT ENFRALCTGEKG+G SGKPLHYK S FHRIIP+FM+Q            ESIYG+KF DENFK+KH+ PGLLSMANAGP+TNGSQFFITTV TSWLDGRH VFG+V+ GMD+V  +E+ G Q+GTP   + +  +
Sbjct:   27 KITNKVFFDIEIDNKPAGRIVFGLYGKTVPKTVENFRALCTGEKGLGTSGKPLHYKDSKFHRIIPNFMIQGGDFTRGDGTGGESIYGKKFNDENFKIKHSKPGLLSMANAGPNTNGSQFFITTVVTSWLDGRHTVFGEVIEGMDIVKLLESIGSQSGTPSKIAKISNS 194          
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Match: CYP7_CAEEL (Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhabditis elegans GN=cyn-7 PE=1 SV=2)

HSP 1 Score: 239.195 bits (609), Expect = 1.398e-62
Identity = 111/158 (70.25%), Postives = 129/158 (81.65%), Query Frame = 2
Query:  155 KVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKSK 628
            +V+FD+ IAGKP GRIVM L+   VPKTAENFRALCTGEKG+GKSGKPLH+KGS FHRIIP FM+Q            ESIYGEKFPDENFK KHTGPG+LSMANAGP+TNGSQFF+ TV T+WLDG+HVVFG+V+ G+D+V KVE  G  +GTPKS+
Sbjct:    5 RVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNGSSSGTPKSE 162          
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Match: CYP3_CAEEL (Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhabditis elegans GN=cyn-3 PE=1 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 9.377e-59
Identity = 107/156 (68.59%), Postives = 124/156 (79.49%), Query Frame = 2
Query:  152 NKVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTP 619
            +KV+FD+ I GK +GRIVM L+   VPKTA NFRALCTGE GIGKSGKPLH+KGS FHRIIP+FM+Q            ESIYGEKFPDENFK KHTGPG+LSMANAGP+TNGSQFF+ TV T WLDG+HVVFG+V+ G+DVV  VE+ G Q+G P
Sbjct:    4 SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKP 159          
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Match: CYPH_MAIZE (Peptidyl-prolyl cis-trans isomerase OS=Zea mays GN=CYP PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 3.335e-56
Identity = 103/154 (66.88%), Postives = 118/154 (76.62%), Query Frame = 2
Query:  155 KVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGT 616
            +V+FD+ + G PAGRIVM L+   VPKTAENFRALCTGEKG+GKSGKPLHYKGSTFHR+IP FM Q            ESIYGEKFPDE F  K   PG+LSMANAGP+TNGSQFFI TV T WLDG+HVVFG+V+ GMDVV  +E  G +NG+
Sbjct:    5 RVFFDMTVGGAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKQPAPGVLSMANAGPNTNGSQFFICTVATPWLDGKHVVFGQVVEGMDVVKAIEKVGTRNGS 158          
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Match: CYPH_SOLLC (Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum GN=CYP PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 5.689e-56
Identity = 103/153 (67.32%), Postives = 115/153 (75.16%), Query Frame = 2
Query:  155 KVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNG 613
            KV+FD+ I G PAGR+VM LF    PKTAENFRALCTGEKG+GK GKPLHYKGSTFHR+IP FM Q            ESIYG KF DENF  KHTGPG+LSMANAGP TNGSQFFI T  T WL+G+HVVFG+V+ GMDV+ K EA G  +G
Sbjct:    5 KVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSG 157          
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Match: CYP2_CAEEL (Peptidyl-prolyl cis-trans isomerase 2 OS=Caenorhabditis elegans GN=cyn-2 PE=2 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 5.689e-56
Identity = 103/157 (65.61%), Postives = 121/157 (77.07%), Query Frame = 2
Query:  155 KVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTPKS 625
            KV+FD+ I GK  GRIVM L+   VPKTAENFRALCTGEKG GKSGK LH+KGS FHRIIP FM+Q            ESI+GEKF DENFK KHTGPG+LSMAN G +TNGSQFF+ TV T+WLDG+HVVFGKV+ GMDVV  +E++G ++G P +
Sbjct:    5 KVFFDITIGGKKGGRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFHRIIPEFMIQGGDFTEGNGTGGESIHGEKFDDENFKEKHTGPGVLSMANCGANTNGSQFFLCTVKTTWLDGKHVVFGKVIEGMDVVKAIESKGSEDGAPSA 161          
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Match: CP19B_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana GN=CYP19-2 PE=1 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.073e-54
Identity = 100/155 (64.52%), Postives = 119/155 (76.77%), Query Frame = 2
Query:  155 KVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNGTP 619
            KV+FD+ I G PAG+IVM L+    PKTAENFRALCTGEKG+G+SGKPLH+KGS+FHR+IP+FM Q            ESIYG KF DENF+ KHTGPG+LSMANAG +TNGSQFFI TV T WLDG+HVVFG+V+ G+DVV  +E  G  +G P
Sbjct:    6 KVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSSFHRVIPNFMCQGGDFTKGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSGKP 160          
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Match: CYPH_LUPLU (Peptidyl-prolyl cis-trans isomerase OS=Lupinus luteus PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.390e-54
Identity = 101/153 (66.01%), Postives = 116/153 (75.82%), Query Frame = 2
Query:  155 KVYFDVEIAGKPAGRIVMGLFGKAVPKTAENFRALCTGEKGIGKSGKPLHYKGSTFHRIIPSFMLQXXXXXXXXXXXXESIYGEKFPDENFKLKHTGPGLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKVEAEGRQNG 613
            KV+FD+ IAG PAGRIVM L+    P+TAENFRALCTGEKG+G+SGKPLHYKGSTFHR+IP+FM Q            ESIYG KF DENF  +HTGPG+LSMANAG  TNGSQFFI T  T WLDG+HVVFGKV+ GM+VV  +E  G  +G
Sbjct:    5 KVFFDMAIAGNPAGRIVMELYADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSTFHRVIPNFMCQGGDFTAGNGTGAESIYGAKFADENFIKRHTGPGILSMANAGAGTNGSQFFICTEKTEWLDGKHVVFGKVIEGMNVVRDIEKVGSGSG 157          
The following BLAST results are available for this feature:
BLAST of BQ623093 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 225
Match NameE-valueIdentityDescription
CP20A_ARATH8.158e-7982.86Peptidyl-prolyl cis-trans isomerase CYP20-1 OS=Ara... [more]
CP19D_ARATH9.972e-7775.68Peptidyl-prolyl cis-trans isomerase CYP19-4 OS=Ara... [more]
PPIB_DICDI1.070e-6267.26Peptidyl-prolyl cis-trans isomerase B OS=Dictyoste... [more]
CYP7_CAEEL1.398e-6270.25Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhab... [more]
CYP3_CAEEL9.377e-5968.59Peptidyl-prolyl cis-trans isomerase 3 OS=Caenorhab... [more]
CYPH_MAIZE3.335e-5666.88Peptidyl-prolyl cis-trans isomerase OS=Zea mays GN... [more]
CYPH_SOLLC5.689e-5667.32Peptidyl-prolyl cis-trans isomerase OS=Solanum lyc... [more]
CYP2_CAEEL5.689e-5665.61Peptidyl-prolyl cis-trans isomerase 2 OS=Caenorhab... [more]
CP19B_ARATH1.073e-5464.52Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Ara... [more]
CYPH_LUPLU2.390e-5466.01Peptidyl-prolyl cis-trans isomerase OS=Lupinus lut... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00184 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00184 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623093 ID=BQ623093|Name=BQ623093|organism=Citrus sinensis|type=EST|length=646bp
GTGAGTGACTGCGAAACGAGAAACAACGAAGTGATACATGGCTTCGACAA
ATTTGCTTCCACTCACAGATGCTATGGGCCTGTTGTCCTGTTGGCCACCT
TTCTCTTCAATTCAGGCGAAGAAATCGGATCAGAATTTGAAAGAAATCAC
AAACAAAGTTTACTTTGACGTTGAGATTGCCGGAAAACCTGCCGGACGTA
TTGTAATGGGTCTCTTTGGAAAGGCAGTCCCTAAAACTGCAGAAAATTTC
CGAGCTTTGTGCACAGGGGAGAAAGGGATTGGCAAGAGTGGGAAGCCACT
CCACTACAAGGGAAGTACGTTTCATAGGATTATTCCCAGCTTTATGCTTC
AAGGAGGTGATTTCACTCTTGGTGATGGAAGAGGTGGAGAGTCAATTTAT
GGAGAGAAGTTCCCTGACGAAAATTTCAAACTGAAGCACACCGGCCCAGG
GCTTTTGTCAATGGCAAATGCTGGGCCAGACACCAATGGTTCACAATTCT
TCATTACAACTGTGACAACTAGCTGGTTGGATGGCAGGCATGTTGTATTT
GGAAAGGTGCTATCGGGGATGGATGTAGTTTACAAGGTTGAAGCTGAAGG
GAGGCAGAATGGCACTCCGAAAAGCAAGTCGTCATTGCAGACAGCG
back to top