BQ623095

Overview
NameBQ623095
Unique NameBQ623095
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length558
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1721 contig Csv1_Contig1721:101..658. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Match: FER2_ARATH (Ferredoxin-2, chloroplastic OS=Arabidopsis thaliana GN=FD2 PE=1 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 2.993e-54
Identity = 103/142 (72.54%), Postives = 122/142 (85.92%), Query Frame = 3
Query:   18 LSSAMVSTSFIRSKPTATSLKAMPNMG-QAMFGLKAN--RGGRVVAMATYKVKLITPGGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 434
            LSSA+V TSFIR  P   SL+++P+   Q++FGLK+   RGGRV AMATYKVK ITP GE E+ C DD ++LDAAEEAG+DLPYSCRAG+CSSC GKVVSG+VDQS+QSFLDD+Q+GEGFVLTCAAYPTSDVTIETHKEE++
Sbjct:    6 LSSAIVGTSFIRRSPAPISLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFITPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEDI 147          
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Match: FER_CAPAN (Ferredoxin, chloroplastic OS=Capsicum annuum GN=AP1 PE=1 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 2.145e-52
Identity = 95/144 (65.97%), Postives = 117/144 (81.25%), Query Frame = 3
Query:    9 MATLSSAMVSTSFIRSKPTATSLKAMPNMGQAMFGLKANRGGRVVAMATYKVKLITPGGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEELAG 440
            MA++S+ M+STSF+  KP  TSLK +PN+G+A+FGLK+  GG+V  MA+YKVKLITP G  E +CPD+ +ILD AEEAG DLPYSCRAG+CSSC GK+  G VDQ++ +FLDDDQ+ EG+VLTC AYP SDVTIETHKE EL G
Sbjct:    1 MASVSATMISTSFMPRKPAVTSLKPIPNVGEALFGLKSANGGKVTCMASYKVKLITPDGPIEFDCPDNVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLEEGWVLTCVAYPQSDVTIETHKEAELVG 144          
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Match: FER1_ARATH (Ferredoxin-1, chloroplastic OS=Arabidopsis thaliana GN=FD1 PE=1 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 3.659e-52
Identity = 99/142 (69.72%), Postives = 121/142 (85.21%), Query Frame = 3
Query:   18 LSSAMVSTSFIRSKPTATSLKAMPNMG-QAMFGLKAN--RGGRVVAMATYKVKLITPGGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 434
            LSSA+VSTSF+R + T  SL+++P    Q++FGLK++  RGGRV AMATYKVK ITP GE+E+ C +D ++LDAAEEAGLDLPYSCRAG+CSSC GKVVSG++DQS+QSFLDD+QM EG+VLTC AYPTSDV IETHKEE +
Sbjct:    6 LSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFITPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDVVIETHKEEAI 147          
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Match: FER1_SOLLC (Ferredoxin-1, chloroplastic OS=Solanum lycopersicum GN=SEND33 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.065e-51
Identity = 95/142 (66.90%), Postives = 113/142 (79.58%), Query Frame = 3
Query:    9 MATLSSAMVSTSFIRSKPTATSLKAMPNMGQAMFGLKANRGGRVVAMATYKVKLITPGGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 434
            MA++S  M+STSF+  KP  TSLKA+ N+G+A+FGLK+ R GR+  MA+YKVKLITP G  E  CPDD +ILD AEE G DLPYSCRAG+CSSC GKV +G+VDQS+ +FLD+DQ   GFVLTC AYP  DVTIETHKEEEL
Sbjct:    1 MASISGTMISTSFLPRKPAVTSLKAISNVGEALFGLKSGRNGRITCMASYKVKLITPEGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGSVDQSDGNFLDEDQEAAGFVLTCVAYPKGDVTIETHKEEEL 142          
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Match: FER1_MESCR (Ferredoxin-1, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 7.141e-48
Identity = 95/145 (65.52%), Postives = 116/145 (80.00%), Query Frame = 3
Query:    6 TMATLSSAMVSTSFIRSKPTATSLKAMP-NMGQAMFGLKANRG-GRVVAMATYKVKLITPGGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 434
            T A LS A +ST+F    P  T+  A+P N+G+A+FGLK++   GRV AMA YKV L+TP G++E+ CPDD +ILDAAEEAG+DLPYSCRAG+CSSC GKV SG+V+Q + SFLDDDQ+ EG+VLTC AYPT DVTIETHKEEEL
Sbjct:    4 TTAALSGATMSTAFAPKTPPMTA--ALPTNVGRALFGLKSSASRGRVTAMAAYKVTLVTPEGKQELECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVTSGSVNQDDGSFLDDDQIKEGWVLTCVAYPTGDVTIETHKEEEL 146          
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Match: FER_SILPR (Ferredoxin, chloroplastic OS=Silene pratensis GN=PETF PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 6.684e-46
Identity = 91/142 (64.08%), Postives = 109/142 (76.76%), Query Frame = 3
Query:   12 ATLSSAMVSTSFIRSKPTATSLKAMPNMGQAMFGLKANRGGRVVAMATYKVKLITP-GGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 434
            +TLS+  VS S +  +    +     NMGQA+FGLKA   GRV AMATYKV LIT   G    +CPDD ++LD AEE G+DLPYSCRAG+CSSC GKVV+G+VDQS+QSFLDDDQ+  G+VLTCAAYP++DVTIETHKEEEL
Sbjct:    3 STLSTLSVSASLLPKQQPMVASSLPTNMGQALFGLKAGSRGRVTAMATYKVTLITKESGTVTFDCPDDVYVLDQAEEEGIDLPYSCRAGSCSSCAGKVVAGSVDQSDQSFLDDDQIEAGWVLTCAAYPSADVTIETHKEEEL 144          
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Match: FER1_PEA (Ferredoxin-1, chloroplastic OS=Pisum sativum GN=PETF PE=1 SV=2)

HSP 1 Score: 176.407 bits (446), Expect = 8.170e-44
Identity = 87/145 (60.00%), Postives = 102/145 (70.34%), Query Frame = 3
Query:    6 TMATLSSAMVSTSFIRSKPTATSLKAMPNMGQAMFGLKAN--RGGRVVAMATYKVKLITPGGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 434
            T   L    VSTSF+R++P   S+           GLK +  RG   VAMA+YKVKL+TP G +E  CP D +ILD AEE G+DLPYSCRAG+CSSC GKVV G VDQS+ SFLDD+Q+  GFVLTC AYPTSDV IETHKEE+L
Sbjct:    3 TTPALYGTAVSTSFLRTQPMPMSVTTTKAFSNGFLGLKTSLKRGDLAVAMASYKVKLVTPDGTQEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDDEQIEAGFVLTCVAYPTSDVVIETHKEEDL 147          
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Match: FER1_SPIOL (Ferredoxin-1, chloroplastic OS=Spinacia oleracea GN=PETF PE=1 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 5.296e-43
Identity = 87/144 (60.42%), Postives = 112/144 (77.78%), Query Frame = 3
Query:   12 ATLSSAM-VSTSFIRSKPTATSLKAMP-NMGQAMFGLKA-NRGGRVVAMATYKVKLITPGGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 434
            AT ++ M ++T+F+        + A+P N G+++FGLK  +RGGR+  MA YKV L+TP G  E  CPDD +ILDAAEE G+DLPYSCRAG+CSSC GK+ +G+++Q +QSFLDDDQ+ EG+VLTCAAYP SDVTIETHKEEEL
Sbjct:    3 ATTTTMMGMATTFVPKPQAPPMMAALPSNTGRSLFGLKTGSRGGRMT-MAAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEEL 145          
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Match: FER_BRANA (Ferredoxin OS=Brassica napus PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 7.647e-42
Identity = 78/95 (82.11%), Postives = 87/95 (91.58%), Query Frame = 3
Query:  150 ATYKVKLITPGGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 434
            ATYKVK ITP GE+E+ C DD ++LDAAEEAG+DLPYSCRAG+CSSC GKVVSG VDQS++SFLDDDQ+ EGFVLTCAAYPTSDVTIETHKEEEL
Sbjct:    1 ATYKVKFITPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFVDQSDESFLDDDQIAEGFVLTCAAYPTSDVTIETHKEEEL 95          
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Match: FER3_RAPSA (Ferredoxin, leaf L-A OS=Raphanus sativus PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.304e-41
Identity = 76/95 (80.00%), Postives = 88/95 (92.63%), Query Frame = 3
Query:  150 ATYKVKLITPGGEEEINCPDDTFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 434
            ATYKVK ITP GE+E+ C DD ++LDAAEEAG+DLPYSCRAG+CSSC GKVVSG+VDQS+QSFLDDDQ+ EGFVLTCAAYPTSDVTIETH+EE++
Sbjct:    1 ATYKVKFITPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQIAEGFVLTCAAYPTSDVTIETHREEDM 95          
The following BLAST results are available for this feature:
BLAST of BQ623095 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 110
Match NameE-valueIdentityDescription
FER2_ARATH2.993e-5472.54Ferredoxin-2, chloroplastic OS=Arabidopsis thalian... [more]
FER_CAPAN2.145e-5265.97Ferredoxin, chloroplastic OS=Capsicum annuum GN=AP... [more]
FER1_ARATH3.659e-5269.72Ferredoxin-1, chloroplastic OS=Arabidopsis thalian... [more]
FER1_SOLLC1.065e-5166.90Ferredoxin-1, chloroplastic OS=Solanum lycopersicu... [more]
FER1_MESCR7.141e-4865.52Ferredoxin-1, chloroplastic OS=Mesembryanthemum cr... [more]
FER_SILPR6.684e-4664.08Ferredoxin, chloroplastic OS=Silene pratensis GN=P... [more]
FER1_PEA8.170e-4460.00Ferredoxin-1, chloroplastic OS=Pisum sativum GN=PE... [more]
FER1_SPIOL5.296e-4360.42Ferredoxin-1, chloroplastic OS=Spinacia oleracea G... [more]
FER_BRANA7.647e-4282.11Ferredoxin OS=Brassica napus PE=1 SV=1[more]
FER3_RAPSA1.304e-4180.00Ferredoxin, leaf L-A OS=Raphanus sativus PE=1 SV=1[more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00186 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00186 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623095 ID=BQ623095|Name=BQ623095|organism=Citrus sinensis|type=EST|length=558bp
CAACAACAATGGCCACCCTCTCAAGCGCCATGGTAAGCACCTCATTCATC
AGAAGCAAGCCTACAGCGACCAGCCTCAAAGCCATGCCTAACATGGGTCA
GGCTATGTTTGGCCTCAAAGCCAACAGAGGTGGCCGTGTTGTAGCCATGG
CTACATACAAAGTCAAGCTCATTACACCTGGGGGAGAGGAAGAAATCAAC
TGTCCTGATGACACGTTTATTCTTGATGCTGCTGAAGAAGCTGGGCTTGA
TCTTCCGTACTCATGCAGGGCTGGGGCTTGCTCTTCCTGTACTGGGAAAG
TTGTGTCTGGAACCGTTGACCAGTCGGAGCAAAGCTTTCTGGATGATGAT
CAAATGGGAGAAGGTTTTGTTCTCACTTGTGCTGCTTATCCAACAAGTGA
TGTTACTATAGAGACTCACAAGGAAGAGGAGCTCGCTGGTTAATAATGTG
CTCTTGATATCTCATTATTATCTTCTCTTTTATGTGGTGGGTTTTGTCTG
ATTATTTTAATGCTTTGAAAGGGATATTGGGTTACAAAAAAAAAAATAAA
GAAACTCG
back to top