BQ623105

Overview
NameBQ623105
Unique NameBQ623105
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length593
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10 contig Csv1_Contig10:1..593. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623105 vs. ExPASy Swiss-Prot
Match: ARID2_HUMAN (AT-rich interactive domain-containing protein 2 OS=Homo sapiens GN=ARID2 PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 1.658e-16
Identity = 44/106 (41.51%), Postives = 64/106 (60.38%), Query Frame = 3
Query:   27 PPTAKYEDIAQSSDLFWATLEAFHKSFGDKFK-VPTVGGKALDLHRLFVEVTSRGGLGKVPRDRRWKEVVVVFNFPTTITSASFVLRKYYLSLLYHFEQVYYFRKE 341
            PP  + + +A     F   L  FH S G  FK +P VGGK LDLH L+  VT+ GG  KV    +W E+V  FNFP + ++A+F L++YYL  L  +E+V++F ++
Sbjct:    9 PPDERRKGLA-----FLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGED 109          
The following BLAST results are available for this feature:
BLAST of BQ623105 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
ARID2_HUMAN1.658e-1641.51AT-rich interactive domain-containing protein 2 OS... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00196 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00196 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623105 ID=BQ623105|Name=BQ623105|organism=Citrus sinensis|type=EST|length=593bp
ACAGCAAGGCATCCAGTTACTACCCTCCACCAACAGCCAAGTACGAGGAT
ATTGCTCAGAGTTCTGATCTTTTCTGGGCTACTCTCGAAGCATTTCACAA
GTCTTTTGGTGACAAATTCAAGGTTCCTACTGTAGGAGGAAAGGCGCTCG
ATCTGCATCGCCTTTTTGTGGAGGTGACATCTCGTGGTGGTCTTGGAAAG
GTACCTAGAGATCGTAGATGGAAGGAAGTGGTTGTGGTCTTCAACTTTCC
CACAACGATTACCAGTGCATCATTTGTATTACGGAAGTATTATCTCTCAT
TACTTTACCACTTCGAGCAAGTCTACTACTTCCGCAAAGAAGCTCCTTCA
TCGTCAATGCCTGATGCTGTAAGCGGGAGCAGCCTTGACAATGGATCAGC
ATCCCCAGAGGAAGGTTCCACAATTAACCAGTTGGGCGGTCAGGGGAGTT
CAAAATTGCAGATTGGCTGTTCAGTTTCTGGAGTCATTGATGGGAAATTT
GATAATGGATATCTGGTCACTGTGAACTTGGGTTCTGAACAACTTAAAGG
TGTCTTATATCATATTCCTCATGCACATAATGTGGCTCAAAGT
back to top