BQ623109

Overview
NameBQ623109
Unique NameBQ623109
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length454
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6249 contig Csv1_Contig6249:289..742. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Match: RBS_LACSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Lactuca sativa GN=RBCS PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 9.703e-48
Identity = 83/102 (81.37%), Postives = 94/102 (92.16%), Query Frame = 2
Query:    2 SDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPGV 307
            SDEAL KEI+YLIR+ WIPCLEFELE G+VYREHH SPGYYDGRYWTMWKLPM+GCTD+ QV+KEVGE +KEYP++F+R+IGFDN RQVQCISFI AKPPGV
Sbjct:   79 SDEALSKEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISFIVAKPPGV 180          
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Match: RBS3_SOLTU (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Solanum tuberosum GN=RBCS-3 PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 4.983e-44
Identity = 77/101 (76.24%), Postives = 89/101 (88.12%), Query Frame = 2
Query:    2 SDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 304
            SDE LLKE+ YL+++GW+PCLEFE E G+VYRE+HKSPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISFIA KP G
Sbjct:   80 SDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180          
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Match: RBS_CAPAN (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Capsicum annuum GN=RBCS PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 6.508e-44
Identity = 77/99 (77.78%), Postives = 87/99 (87.88%), Query Frame = 2
Query:    2 SDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKP 298
            SDE LLKEI YL++ GW+PCLEFE E G+VYREHH+SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISFIA KP
Sbjct:   79 SDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177          
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Match: RBS_GLYTA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Glycine tabacina GN=RBCS PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 8.500e-44
Identity = 76/99 (76.77%), Postives = 87/99 (87.88%), Query Frame = 2
Query:    5 DEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPP 301
            D  L KE+ YL+R GWIPCLEFELE G+VYREHH+SPGYYDGRYWTMWKLPM+GCTDA+QVLKE+ E +  YP++F+RIIGFDN RQVQCISFIA KPP
Sbjct:   78 DAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNAFIRIIGFDNVRQVQCISFIAYKPP 176          
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Match: RBS8_NICPL (Ribulose bisphosphate carboxylase small chain 8B, chloroplastic OS=Nicotiana plumbaginifolia GN=RBCS-8B PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 8.500e-44
Identity = 78/101 (77.23%), Postives = 87/101 (86.14%), Query Frame = 2
Query:    2 SDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 304
            S E LL EI YL++SGW+PCLEFE E+G+VYREHH SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP ++VRIIGFDN RQVQCISFIA KP G
Sbjct:   79 SQEQLLSEIEYLLKSGWVPCLEFETERGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179          
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Match: RBS3B_SOLLC (Ribulose bisphosphate carboxylase small chain 3B, chloroplastic OS=Solanum lycopersicum GN=RBCS-3B PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.110e-43
Identity = 78/101 (77.23%), Postives = 88/101 (87.13%), Query Frame = 2
Query:    2 SDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 304
            SDE LL EI YL+++GW+PCLEFE E G+VYRE+HKSPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP ++VRIIGFDN RQVQCISFIA KP G
Sbjct:   79 SDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179          
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Match: RBS3A_SOLLC (Ribulose bisphosphate carboxylase small chain 3A/3C, chloroplastic OS=Solanum lycopersicum GN=RBCS-3A/3C PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.110e-43
Identity = 78/101 (77.23%), Postives = 88/101 (87.13%), Query Frame = 2
Query:    2 SDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 304
            SDE LL EI YL+++GW+PCLEFE E G+VYRE+HKSPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP ++VRIIGFDN RQVQCISFIA KP G
Sbjct:   79 SDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179          
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Match: RBS1_SOLTU (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Solanum tuberosum GN=RBCS-1 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.110e-43
Identity = 76/101 (75.25%), Postives = 89/101 (88.12%), Query Frame = 2
Query:    2 SDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 304
            +DE LLKE+ YL+++GW+PCLEFE E G+VYRE+HKSPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISFIA KP G
Sbjct:   80 TDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180          
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Match: RBS_PYRPY (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Pyrus pyrifolia GN=RBCS PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 2.473e-43
Identity = 75/101 (74.26%), Postives = 89/101 (88.12%), Query Frame = 2
Query:    2 SDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 304
            S E+L KE++YL+R  W+PCLEFELE G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISFIA KP G
Sbjct:   82 SSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Match: RBS_MALSP (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Malus sp. GN=RBCS PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 3.230e-43
Identity = 75/101 (74.26%), Postives = 89/101 (88.12%), Query Frame = 2
Query:    2 SDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 304
            S E+L KE++YL+R  W+PCLEFELE G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISFIA KP G
Sbjct:   82 STESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
The following BLAST results are available for this feature:
BLAST of BQ623109 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 120
Match NameE-valueIdentityDescription
RBS_LACSA9.703e-4881.37Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS3_SOLTU4.983e-4476.24Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS_CAPAN6.508e-4477.78Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_GLYTA8.500e-4476.77Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS8_NICPL8.500e-4477.23Ribulose bisphosphate carboxylase small chain 8B, ... [more]
RBS3B_SOLLC1.110e-4377.23Ribulose bisphosphate carboxylase small chain 3B, ... [more]
RBS3A_SOLLC1.110e-4377.23Ribulose bisphosphate carboxylase small chain 3A/3... [more]
RBS1_SOLTU1.110e-4375.25Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS_PYRPY2.473e-4374.26Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MALSP3.230e-4374.26Ribulose bisphosphate carboxylase small chain, chl... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00200 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00200 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623109 ID=BQ623109|Name=BQ623109|organism=Citrus sinensis|type=EST|length=454bp
GTCCGATGAAGCTTTGCTCAAGGAAATCAATTACCTTATCCGCTCCGGCT
GGATTCCCTGCTTGGAATTCGAGTTGGAGAAAGGATGGGTGTACCGTGAG
CACCACAAGTCACCAGGATACTACGATGGACGCTACTGGACAATGTGGAA
GCTGCCCATGTATGGGTGCACAGATGCAACCCAGGTTTTGAAGGAGGTTG
GGGAGGTCCAGAAGGAATACCCACATTCATTCGTCCGAATTATCGGATTT
GACAACAAGCGTCAAGTGCAGTGCATCAGTTTCATTGCTGCCAAGCCACC
AGGCGTCTAGGTTCCCAATTAAATTTATGTAACCACCCATGCAATATTGT
TGATTATTATTATGTGTAACCCCCATAATGATCATTCGATCAATGGGGGT
TCGGTTTGCGTTTAATTTGTACTTAGGCTGCTGTTGCTGCTGCTCAAACT
TTTT
back to top