BQ623186

Overview
NameBQ623186
Unique NameBQ623186
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12 contig Csv1_Contig12:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_LOTJA (Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 5.000e-88
Identity = 158/166 (95.18%), Postives = 162/166 (97.59%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN+AKKWIPELRHYAPGVPIILVGTKLDLRDDK FLADHPGAVPITTAQGEELRKLIGAP YIECSSKTQQNVKAVFDAAIKVVLQPPK  KKK+
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKHFLADHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKR 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC3_ARATH (Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 1.455e-87
Identity = 153/168 (91.07%), Postives = 165/168 (98.21%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYTSNTFPTDYVPTVFDNFSANV+VDG+T+NLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSL+SKASYENV+KKW+PELRHYAPGVPIILVGTKLDLRDDKQF A+HPGAVPI+TAQGEEL+KLIGAP YIECS+KTQQNVKAVFDAAIKVVLQPPKN KKKKR+
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKLDLRDDKQFFAEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVLQPPKNKKKKKRK 190          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC5_ARATH (Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 7.220e-87
Identity = 155/168 (92.26%), Postives = 162/168 (96.43%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYTSNTFPTDYVPTVFDNFSANVVVDG+TVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQF  DHPGAVPITT QGEEL+KLIG+P+YIECSSKTQQNVKAVFDAAIKVVLQPPK  KKKK +
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNK 190          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC5_ORYSJ (Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2)

HSP 1 Score: 319.316 bits (817), Expect = 9.430e-87
Identity = 156/167 (93.41%), Postives = 161/167 (96.41%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAPGVPIILVGTKLDLRDDKQF  DHPGAVPI+TAQGEELRKLIGA  YIECSSKTQQN+KAVFDAAIKVVLQPPK  KKKK+
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFVDHPGAVPISTAQGEELRKLIGAAAYIECSSKTQQNIKAVFDAAIKVVLQPPKQKKKKKK 189          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC4_ARATH (Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 6.112e-86
Identity = 154/168 (91.67%), Postives = 161/168 (95.83%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKRR 608
            +ISYTSNTFPTDYVPTVFDNFSANVVVDG+TVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN+AKKWIPELRHYAPGVPIILVGTKLDLRDDKQF  DHPGAVPITT QGEEL+KLIG+ VYIECSSKTQQNVKAVFDAAIKVVLQPPK  KKKK +
Sbjct:   22 LISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNK 189          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_BETVU (Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 6.112e-86
Identity = 153/167 (91.62%), Postives = 161/167 (96.41%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYTSNTFPTDYVPTVFDNFSANVVV+G+TVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPEL+HYAPGVPI+LVGTKLDLRDDKQF  DHPGAVPITTAQGEELRKLIGAP YIECSSKTQQNVKAVFDAAIKVVLQPPK  KKK +
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQPPKTKKKKSK 189          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RHO1_PEA (Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 5.174e-85
Identity = 152/167 (91.02%), Postives = 160/167 (95.81%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYTSNTFPTDYVPTVFDNFSANVVV+GSTVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPEL+HYAPGVPIILVGTKLDLRDDKQF  DHPGAVPITTAQGEELRKLI AP YIECSSK+QQNVKAVFDAAI+VVLQPPK  KKK +
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKLDLRDDKQFFVDHPGAVPITTAQGEELRKLINAPAYIECSSKSQQNVKAVFDAAIRVVLQPPKQKKKKSK 189          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC6_ORYSJ (Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 5.174e-85
Identity = 154/166 (92.77%), Postives = 158/166 (95.18%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKK 602
            +ISYTSNTFPTDYVPTVFDNFSANVVVDG+TVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPEL+HYAPGVPIILVGTKLDLRDDKQF  DHPGAVPITTAQGEELRK IGAP YIECSSKTQ NVK VFDAAIKVVLQPPK  KKKK
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKLDLRDDKQFFVDHPGAVPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAAIKVVLQPPKAKKKKK 188          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC11_ARATH (Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 6.758e-85
Identity = 151/167 (90.42%), Postives = 160/167 (95.81%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYTSNTFPTDYVPTVFDNFSANVVV+GSTVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPEL+HYAPGVPI+LVGTKLDLRDDKQF  DHPGAVPITTAQGEELRK IGAP YIECSSKTQ+NVKAVFDAAI+VVLQPPK  KKK +
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELRKQIGAPTYIECSSKTQENVKAVFDAAIRVVLQPPKQKKKKSK 189          
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Match: RAC1_ARATH (Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 1.966e-84
Identity = 149/167 (89.22%), Postives = 160/167 (95.81%), Query Frame = 3
Query:  105 VISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQPPKNTKKKKR 605
            +ISYTSNTFPTDYVPTVFDNFSANVVV+G+TVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPEL+HYAPGVPI+LVGTKLDLRDDKQF  DHPGAVPITTAQGEEL+KLIGAP YIECSSKTQ+NVK VFDAAI+VVLQPPK  KKK +
Sbjct:   23 LISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQENVKGVFDAAIRVVLQPPKQKKKKSK 189          
The following BLAST results are available for this feature:
BLAST of BQ623186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAC1_LOTJA5.000e-8895.18Rac-like GTP-binding protein RAC1 OS=Lotus japonic... [more]
RAC3_ARATH1.455e-8791.07Rac-like GTP-binding protein ARAC3 OS=Arabidopsis ... [more]
RAC5_ARATH7.220e-8792.26Rac-like GTP-binding protein ARAC5 OS=Arabidopsis ... [more]
RAC5_ORYSJ9.430e-8793.41Rac-like GTP-binding protein 5 OS=Oryza sativa sub... [more]
RAC4_ARATH6.112e-8691.67Rac-like GTP-binding protein ARAC4 OS=Arabidopsis ... [more]
RAC1_BETVU6.112e-8691.62Rac-like GTP-binding protein RHO1 OS=Beta vulgaris... [more]
RHO1_PEA5.174e-8591.02Rac-like GTP-binding protein RHO1 OS=Pisum sativum... [more]
RAC6_ORYSJ5.174e-8592.77Rac-like GTP-binding protein 6 OS=Oryza sativa sub... [more]
RAC11_ARATH6.758e-8590.42Rac-like GTP-binding protein ARAC11 OS=Arabidopsis... [more]
RAC1_ARATH1.966e-8489.22Rac-like GTP-binding protein ARAC1 OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00277 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00277 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623186 ID=BQ623186|Name=BQ623186|organism=Citrus sinensis|type=EST|length=610bp
GTAATAAAGATACTGTCTTAAGTGCACGTGGCGCGAGATGAGTGCATCGA
GGTTCATAAAGTGCGTGACGGTCGGTGACGGCGCCGTCGGCAAGACTTGC
ATGCGTCATTTCTTACACCAGCAACACTTTCCCGACGGATTATGTGCCAA
CAGTATTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGAAGCACTGTT
AATCTTGGGTTGTGGGACACTGCAGGCCAGGAAGATTACAATAGACTAAG
ACCATTGAGCTACCGCGGGGCAGATGTCTTCTTACTCGCATTCTCTCTCA
TTAGCAAGGCCAGCTATGAAAATGTTGCTAAGAAATGGATTCCTGAGTTG
AGGCATTATGCACCTGGTGTTCCAATAATTCTTGTCGGGACGAAGCTCGA
TCTTCGGGATGATAAGCAGTTCCTTGCAGATCACCCTGGTGCAGTGCCAA
TTACCACGGCCCAAGGGGAGGAATTGAGAAAGTTGATAGGTGCTCCTGTT
TACATTGAGTGTAGTTCCAAAACACAACAGAATGTGAAAGCTGTCTTTGA
TGCGGCCATCAAGGTGGTTCTCCAGCCGCCAAAGAACACGAAGAAAAAGA
AGAGAAGGCC
back to top