BQ623188

Overview
NameBQ623188
Unique NameBQ623188
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length576
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1260 contig Csv1_Contig1260:580..1152. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 3.657e-85
Identity = 121/142 (85.21%), Postives = 124/142 (87.32%), Query Frame = 3
Query:   99 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELK 524
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELK
Sbjct:   67 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELK 208          

HSP 2 Score: 73.9442 bits (180), Expect = 3.657e-85
Identity = 32/33 (96.97%), Postives = 33/33 (100.00%), Query Frame = 2
Query:    2 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYI 100
            MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSY+
Sbjct:   35 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYL 67          

HSP 3 Score: 32.7278 bits (73), Expect = 3.657e-85
Identity = 15/16 (93.75%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  523 KVKELKNGRLAMFYMF 570
            KVKELKNGRLAMF MF
Sbjct:  208 KVKELKNGRLAMFSMF 223          
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 3.657e-85
Identity = 121/142 (85.21%), Postives = 124/142 (87.32%), Query Frame = 3
Query:   99 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELK 524
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELK
Sbjct:   67 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELK 208          

HSP 2 Score: 73.9442 bits (180), Expect = 3.657e-85
Identity = 32/33 (96.97%), Postives = 33/33 (100.00%), Query Frame = 2
Query:    2 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYI 100
            MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSY+
Sbjct:   35 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYL 67          

HSP 3 Score: 32.7278 bits (73), Expect = 3.657e-85
Identity = 15/16 (93.75%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  523 KVKELKNGRLAMFYMF 570
            KVKELKNGRLAMF MF
Sbjct:  208 KVKELKNGRLAMFSMF 223          
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 252.677 bits (644), Expect = 6.716e-84
Identity = 122/142 (85.92%), Postives = 124/142 (87.32%), Query Frame = 3
Query:   99 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELK 524
            LTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYR+                AFDPLGLADDPD FAELK
Sbjct:   69 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELK 210          

HSP 2 Score: 68.1662 bits (165), Expect = 6.716e-84
Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 2
Query:    2 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYI 100
            MRRTVKSAP SIWYGPDRPKYLGPFS+Q PSY+
Sbjct:   37 MRRTVKSAPTSIWYGPDRPKYLGPFSDQIPSYL 69          

HSP 3 Score: 31.9574 bits (71), Expect = 6.716e-84
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  523 KVKELKNGRLAMFYMF 570
            KVKE+KNGRLAMF MF
Sbjct:  210 KVKEIKNGRLAMFSMF 225          
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 8.750e-84
Identity = 119/142 (83.80%), Postives = 124/142 (87.32%), Query Frame = 3
Query:   99 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELK 524
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWACQVVLMGFVEGYR+                AFDPLGLADDP+ FAELK
Sbjct:   69 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELK 210          

HSP 2 Score: 70.8626 bits (172), Expect = 8.750e-84
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 2
Query:    2 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYI 100
            MRRTVKSAPQSIWYG DRPKYLGPFSEQTPSY+
Sbjct:   37 MRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYL 69          

HSP 3 Score: 31.9574 bits (71), Expect = 8.750e-84
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  523 KVKELKNGRLAMFYMF 570
            KVKE+KNGRLAMF MF
Sbjct:  210 KVKEIKNGRLAMFSMF 225          
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 1.606e-82
Identity = 117/142 (82.39%), Postives = 122/142 (85.92%), Query Frame = 3
Query:   99 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELK 524
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPE+L KNGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELK
Sbjct:   69 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPDSFAELK 210          

HSP 2 Score: 70.4774 bits (171), Expect = 1.606e-82
Identity = 30/33 (90.91%), Postives = 32/33 (96.97%), Query Frame = 2
Query:    2 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYI 100
            MRRTVKSAP+SIWYGPDRPKYLGPFSEQ PSY+
Sbjct:   37 MRRTVKSAPESIWYGPDRPKYLGPFSEQIPSYL 69          

HSP 3 Score: 32.7278 bits (73), Expect = 1.606e-82
Identity = 15/16 (93.75%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  523 KVKELKNGRLAMFYMF 570
            KVKELKNGRLAMF MF
Sbjct:  210 KVKELKNGRLAMFSMF 225          
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 3.552e-82
Identity = 118/142 (83.10%), Postives = 122/142 (85.92%), Query Frame = 3
Query:   99 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELK 524
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDP+ FAELK
Sbjct:   69 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELK 210          

HSP 2 Score: 70.8626 bits (172), Expect = 3.552e-82
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 2
Query:    2 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYI 100
            MRRTVKSAPQSIWYG DRPKYLGPFSEQTPSY+
Sbjct:   37 MRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYL 69          

HSP 3 Score: 31.9574 bits (71), Expect = 3.552e-82
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  523 KVKELKNGRLAMFYMF 570
            KVKE+KNGRLAMF MF
Sbjct:  210 KVKEIKNGRLAMFSMF 225          
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Match: CB25_SOLLC (Chlorophyll a-b binding protein 5, chloroplastic (Fragment) OS=Solanum lycopersicum GN=CAB5 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 4.635e-82
Identity = 118/142 (83.10%), Postives = 122/142 (85.92%), Query Frame = 3
Query:   99 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELK 524
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDP+ FAELK
Sbjct:   41 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELK 182          

HSP 2 Score: 70.8626 bits (172), Expect = 4.635e-82
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 2
Query:    2 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYI 100
            MRRTVKSAPQSIWYG DRPKYLGPFSEQTPSY+
Sbjct:    9 MRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYL 41          

HSP 3 Score: 31.9574 bits (71), Expect = 4.635e-82
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  523 KVKELKNGRLAMFYMF 570
            KVKE+KNGRLAMF MF
Sbjct:  182 KVKEIKNGRLAMFSMF 197          
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Match: CB23_TOBAC (Chlorophyll a-b binding protein 36, chloroplastic OS=Nicotiana tabacum GN=CAB36 PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 7.854e-82
Identity = 116/142 (81.69%), Postives = 122/142 (85.92%), Query Frame = 3
Query:   99 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELK 524
            LTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILA+WA QVVLMG +EGYR+                AFDPLGLADDP+ FAELK
Sbjct:   69 LTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELK 210          

HSP 2 Score: 70.8626 bits (172), Expect = 7.854e-82
Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 2
Query:    2 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYI 100
            MRRTVKSAPQSIWYG DRPKYLGPFSEQTPSY+
Sbjct:   37 MRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYL 69          

HSP 3 Score: 31.9574 bits (71), Expect = 7.854e-82
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  523 KVKELKNGRLAMFYMF 570
            KVKE+KNGRLAMF MF
Sbjct:  210 KVKEIKNGRLAMFSMF 225          
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Match: CB21_LEMGI (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Lemna gibba PE=3 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 5.002e-81
Identity = 116/142 (81.69%), Postives = 123/142 (86.62%), Query Frame = 3
Query:   99 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELK 524
            LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPE+LSKNGV+FGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYR+                AFDPLGLADDP+ FAELK
Sbjct:   68 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSKNGVQFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELK 209          

HSP 2 Score: 66.6254 bits (161), Expect = 5.002e-81
Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 2
Query:    2 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYI 100
            MRRTVK+ PQSIWYG DRPK+LGPFSEQTPSY+
Sbjct:   36 MRRTVKAVPQSIWYGADRPKFLGPFSEQTPSYL 68          

HSP 3 Score: 31.9574 bits (71), Expect = 5.002e-81
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  523 KVKELKNGRLAMFYMF 570
            KVKE+KNGRLAMF MF
Sbjct:  209 KVKEIKNGRLAMFSMF 224          
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Match: CB21_PINTH (Chlorophyll a-b binding protein type I, chloroplastic OS=Pinus thunbergii PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 9.173e-80
Identity = 113/142 (79.58%), Postives = 120/142 (84.51%), Query Frame = 3
Query:   99 LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELK 524
            LTGEFPGDYGWDTA +SADPETFAKNRELEVIH RWAMLGALGCVFPE+L+KNG+KFGEAVWFKAGAQIFSEGGLDY GNPNLIHAQSILAIWACQVVLMG +EGYR+                AFDPLGLADDP+  AELK
Sbjct:   70 LTGEFPGDYGWDTAAVSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGLKFGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGTLGEGLDPLLPGGAFDPLGLADDPEACAELK 211          

HSP 2 Score: 68.9366 bits (167), Expect = 9.173e-80
Identity = 29/33 (87.88%), Postives = 32/33 (96.97%), Query Frame = 2
Query:    2 MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYI 100
            MRRTV+SAP+SIWYGPDRPKYLGPFSE TPSY+
Sbjct:   38 MRRTVRSAPESIWYGPDRPKYLGPFSEGTPSYL 70          

HSP 3 Score: 31.9574 bits (71), Expect = 9.173e-80
Identity = 14/16 (87.50%), Postives = 15/16 (93.75%), Query Frame = 1
Query:  523 KVKELKNGRLAMFYMF 570
            KVKE+KNGRLAMF MF
Sbjct:  211 KVKEIKNGRLAMFSMF 226          
The following BLAST results are available for this feature:
BLAST of BQ623188 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 71
Match NameE-valueIdentityDescription
CB23_ORYSJ3.657e-8585.21Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_ORYSI3.657e-8585.21Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_GOSHI6.716e-8485.92Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB24_SOLLC8.750e-8483.80Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB215_PEA1.606e-8282.39Chlorophyll a-b binding protein 215, chloroplastic... [more]
CB26_PETSP3.552e-8283.10Chlorophyll a-b binding protein 37, chloroplastic ... [more]
CB25_SOLLC4.635e-8283.10Chlorophyll a-b binding protein 5, chloroplastic (... [more]
CB23_TOBAC7.854e-8281.69Chlorophyll a-b binding protein 36, chloroplastic ... [more]
CB21_LEMGI5.002e-8181.69Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB21_PINTH9.173e-8079.58Chlorophyll a-b binding protein type I, chloroplas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00279 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00279 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623188 ID=BQ623188|Name=BQ623188|organism=Citrus sinensis|type=EST|length=576bp
CATGAGGAGGACTGTCAAATCCGCTCCCCAGAGCATCTGGTACGGCCCAG
ACCGCCCAAAGTACTTGGGACCATTCTCTGAGCAAACACCATCATACATT
GACTGGTGAGTTCCCTGGTGACTATGGCTGGGATACCGCTGGTTTATCAG
CAGACCCCGAGACATTTGCTAAGAACCGTGAGCTAGAGGTGATCCACAGC
AGATGGGCAATGCTTGGAGCTCTTGGCTGCGTCTTCCCTGAAATCCTCTC
CAAGAATGGAGTGAAGTTCGGCGAAGCAGTTTGGTTCAAGGCTGGCGCTC
AAATATTCTCTGAAGGTGGCCTTGACTATCTTGGCAACCCCAACCTCATT
CATGCTCAGAGCATTTTGGCTATCTGGGCCTGCCAGGTTGTGCTTATGGG
TTTTGTTGAAGGATACAGAATTGGTGGCGGTCCTCTTGGTGAAGGACTTG
ACCCACTTTACCCTGGTGGTGCTTTTGACCCACTTGGTTTGGCTGATGAC
CCCGATCAATTTGCTGAGTTGAAAGGTCAAGGAGCTCAAGAATGGCCGTC
TGGCTATGTTCTACATGTTTTGGATT
back to top