BQ623191

Overview
NameBQ623191
Unique NameBQ623191
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length520
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig383 contig Csv1_Contig383:27..546. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CALS8 (Chaperone protein dnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 8.918e-15
Identity = 39/71 (54.93%), Postives = 51/71 (71.83%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A+ KDYY+IL V  +AT+EEI+  Y RLA ++HPD       A  +F+EINEAY+VLSDP KRR+YD  G
Sbjct:    1 MAQKKDYYEILGVPRNATQEEIKRAYRRLAKQYHPDANPGNKEAEEKFKEINEAYEVLSDPEKRRKYDQFG 71          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_THEAC (Chaperone protein dnaJ OS=Thermoplasma acidophilum GN=dnaJ PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.521e-14
Identity = 39/68 (57.35%), Postives = 50/68 (73.53%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPD-KQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYYKIL VD +AT+EEI+  +  LA KWHPD   +++  A  +F+EI+EAY+VLSDP KRR YD  G
Sbjct:    3 KDYYKILGVDRNATDEEIKKAFRELAKKWHPDLHPENKQEAEEKFKEISEAYEVLSDPQKRRMYDQTG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_THEVO (Chaperone protein dnaJ OS=Thermoplasma volcanium GN=dnaJ PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.987e-14
Identity = 39/68 (57.35%), Postives = 48/68 (70.59%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDC-ATSRFQEINEAYQVLSDPVKRREYDSKG 327
            KDYYKIL VD +A+EE+I+  +  LA KWHPD   D    A  +F+EI+EAY+VLSDP KRR YD  G
Sbjct:    3 KDYYKILGVDRNASEEDIKKAFRELAKKWHPDLHPDNKAEAEEKFKEISEAYEVLSDPEKRRIYDQTG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: SCJ1_YEAST (DnaJ-related protein SCJ1 OS=Saccharomyces cerevisiae GN=SCJ1 PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 2.595e-14
Identity = 41/78 (52.56%), Postives = 53/78 (67.95%), Query Frame = 1
Query:  106 LSLLAKP----KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            LSLL  P    +DYY ILE+D DATE+EI+S Y +L+ K+HPDK    + A  +F E+ EAY VLSDP K++ YD  G
Sbjct:   11 LSLLLLPLILAQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIYDQFG 88          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_MYCGA (Chaperone protein dnaJ OS=Mycoplasma gallisepticum GN=dnaJ PE=3 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 2.595e-14
Identity = 35/71 (49.30%), Postives = 54/71 (76.06%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            ++  +DYY+ILEV   AT+++I+  + +LA+K+HPD+ KD D A  +F+E+NEAY+VLSD  KR+ YD+ G
Sbjct:    1 MSSKRDYYEILEVSRSATQQDIKKAFRKLAMKYHPDRNKDSD-AEEKFKEVNEAYEVLSDEEKRKLYDTYG 70          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_HALOH (Chaperone protein dnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.595e-14
Identity = 38/71 (53.52%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A  KDYY+IL V  DA ++EI+  Y RLA K+HPD  KD   A  +F+EI+EAY++LSDP KR  YD  G
Sbjct:    1 MATSKDYYEILGVSRDADQKEIKKAYRRLARKYHPDINKDDPDAEEKFKEISEAYEILSDPDKRARYDQYG 71          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_ANATD (Chaperone protein dnaJ OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.595e-14
Identity = 39/71 (54.93%), Postives = 50/71 (70.42%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +A+ KDYY+IL V  +ATEEEI+  Y RLA ++HPD       A  +F+EINEAY+VLSDP KR+ YD  G
Sbjct:    1 MAQKKDYYEILGVPRNATEEEIKRAYRRLAKQYHPDANPGNKEAEEKFKEINEAYEVLSDPEKRKLYDQFG 71          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_SYMTH (Chaperone protein dnaJ OS=Symbiobacterium thermophilum GN=dnaJ PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.426e-14
Identity = 41/71 (57.75%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  115 LAKPKDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            LAK +DYY+IL V  +ATE EI+  +  LA K+HPD  KD   A  +F+EINEAYQVLSDP KR  YD  G
Sbjct:    4 LAK-RDYYEILGVPRNATEAEIKKAFRNLARKYHPDANKDDPDAAEKFKEINEAYQVLSDPEKRARYDQFG 73          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_CARHZ (Chaperone protein dnaJ OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.426e-14
Identity = 38/67 (56.72%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYDSKG 327
            +DYY+IL V  +AT EEI+  Y +LA K+HPD  KD   A  +F+EINEAY+VLSDP KR  YD  G
Sbjct:    3 RDYYEILGVARNATPEEIKKAYRKLARKYHPDVNKDDPNAAEKFKEINEAYEVLSDPEKRARYDQFG 69          
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Match: DNAJ_THET2 (Chaperone protein dnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 9.860e-14
Identity = 38/64 (59.38%), Postives = 45/64 (70.31%), Query Frame = 1
Query:  127 KDYYKILEVDYDATEEEIRSNYIRLALKWHPDKQKDRDCATSRFQEINEAYQVLSDPVKRREYD 318
            KDYY IL V  +A++EEI+  Y RLALK+HPD+      A  RF+EINEAY VLSDP KR  YD
Sbjct:    2 KDYYAILGVSREASQEEIKKAYRRLALKYHPDRNPGDKEAEERFKEINEAYAVLSDPKKRAAYD 65          
The following BLAST results are available for this feature:
BLAST of BQ623191 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 356
Match NameE-valueIdentityDescription
DNAJ_CALS88.918e-1554.93Chaperone protein dnaJ OS=Caldicellulosiruptor sac... [more]
DNAJ_THEAC1.521e-1457.35Chaperone protein dnaJ OS=Thermoplasma acidophilum... [more]
DNAJ_THEVO1.987e-1457.35Chaperone protein dnaJ OS=Thermoplasma volcanium G... [more]
SCJ1_YEAST2.595e-1452.56DnaJ-related protein SCJ1 OS=Saccharomyces cerevis... [more]
DNAJ_MYCGA2.595e-1449.30Chaperone protein dnaJ OS=Mycoplasma gallisepticum... [more]
DNAJ_HALOH2.595e-1453.52Chaperone protein dnaJ OS=Halothermothrix orenii (... [more]
DNAJ_ANATD2.595e-1454.93Chaperone protein dnaJ OS=Anaerocellum thermophilu... [more]
DNAJ_SYMTH4.426e-1457.75Chaperone protein dnaJ OS=Symbiobacterium thermoph... [more]
DNAJ_CARHZ4.426e-1456.72Chaperone protein dnaJ OS=Carboxydothermus hydroge... [more]
DNAJ_THET29.860e-1459.38Chaperone protein dnaJ OS=Thermus thermophilus (st... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00282 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00282 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623191 ID=BQ623191|Name=BQ623191|organism=Citrus sinensis|type=EST|length=520bp
GTTTGTGTCCCCTCTACTAAAGAGGTCATGATGTGGGACGAATGGGTCGA
TTGCAACAATAACGATGAACAAACCCAACAGGATTCCCATGTCAATTTTG
ATTTTCTTTCTCTTCTCGCCAAACCCAAGGATTATTATAAAATATTGGAA
GTTGATTACGATGCCACGGAGGAAGAAATTAGGTCCAATTACATTCGTCT
AGCGCTGAAATGGCACCCAGATAAGCAAAAGGATCGAGATTGTGCAACTT
CGAGATTTCAAGAGATAAACGAGGCTTACCAGGTTTTGAGCGATCCTGTC
AAAAGGAGAGAATATGACAGCAAAGGGATGTTGCACATATATGATCGCAA
CATAATTGAGTATCTTAATCGCTACAAGGGCTTAATATTAACTTGCAATG
GTCTTGGGATGAGGCATTCAATTGTGTAATATGTTGTCAGCACAGTTGGG
GCAGTTCATATTGGGAGGCATAGAATTACCAATGCTGCAAATAGCATTGA
GGGCATGGAGAATAGCAGTT
back to top