BQ623194

Overview
NameBQ623194
Unique NameBQ623194
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length541
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8192 contig Csv1_Contig8192:405..943. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623194 vs. ExPASy Swiss-Prot
Match: HS22C_SOYBN (Small heat shock protein, chloroplastic (Fragment) OS=Glycine max GN=HSP22 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.850e-18
Identity = 45/93 (48.39%), Postives = 58/93 (62.37%), Query Frame = 2
Query:   92 PGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKIQAEVKDGVLYITIPKASSTAKIVDINVQ 370
            PG+++ DVKV VE+ MLVIK       E   D S       W S  Y SY TR+ LPDN E +K++AE+K+GVLYITIPK     K++D+ VQ
Sbjct:   96 PGLAKEDVKVSVEDDMLVIKGGHKSEQEHGGDDS-------WSSRTYSSYDTRLKLPDNCEKDKVKAELKNGVLYITIPKTKVERKVIDVQVQ 181          

HSP 2 Score: 23.483 bits (49), Expect = 1.850e-18
Identity = 7/18 (38.89%), Postives = 13/18 (72.22%), Query Frame = 1
Query:   34 RTPWAIRETENDYKIRLD 87
            R PW I++ E++ ++R D
Sbjct:   77 RAPWDIKDEEHEIRMRFD 94          
BLAST of BQ623194 vs. ExPASy Swiss-Prot
Match: HS25P_ARATH (25.3 kDa heat shock protein, chloroplastic OS=Arabidopsis thaliana GN=HSP25.3 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.386e-18
Identity = 39/93 (41.94%), Postives = 60/93 (64.52%), Query Frame = 2
Query:   92 PGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKIQAEVKDGVLYITIPKASSTAKIVDINVQ 370
            PG+S+ DVK+ VE+++LVIK E+ +           + ++ W      SY TR+ LPDN E +KI+AE+K+GVL+ITIPK     K++D+ +Q
Sbjct:  145 PGLSKEDVKISVEDNVLVIKGEQKKE----------DSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ 227          

HSP 2 Score: 27.7202 bits (60), Expect = 2.386e-18
Identity = 12/29 (41.38%), Postives = 17/29 (58.62%), Query Frame = 1
Query:    1 QERVRSGYRRGRTPWAIRETENDYKIRLD 87
            + R  SG    R PW I+E E++ K+R D
Sbjct:  115 RNRGGSGVSEIRAPWDIKEEEHEIKMRFD 143          
BLAST of BQ623194 vs. ExPASy Swiss-Prot
Match: HS21C_SOLLC (Small heat shock protein, chloroplastic OS=Solanum lycopersicum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.859e-18
Identity = 41/92 (44.57%), Postives = 59/92 (64.13%), Query Frame = 2
Query:   92 PGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKIQAEVKDGVLYITIPKASSTAKIVDINV 367
            PG+S+ DVKV VE  MLVIK E  +  +         ++  W  N Y SY TR++LPDNV  +KI+AE+K+GVL+I+IPK     K++D+ +
Sbjct:  151 PGLSKEDVKVSVENDMLVIKGEHKKEEDGR-------DKHSWGRN-YSSYDTRLSLPDNVVKDKIKAELKNGVLFISIPKTEVEKKVIDVQI 234          

HSP 2 Score: 28.4906 bits (62), Expect = 8.859e-18
Identity = 12/24 (50.00%), Postives = 15/24 (62.50%), Query Frame = 1
Query:   16 SGYRRGRTPWAIRETENDYKIRLD 87
            SG    RTPW I + EN+ K+R D
Sbjct:  126 SGTGEIRTPWDIHDDENEIKMRFD 149          
BLAST of BQ623194 vs. ExPASy Swiss-Prot
Match: HS21C_PEA (Small heat shock protein, chloroplastic OS=Pisum sativum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.863e-18
Identity = 42/93 (45.16%), Postives = 58/93 (62.37%), Query Frame = 2
Query:   92 PGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKIQAEVKDGVLYITIPKASSTAKIVDINVQ 370
            PG+S+ DVKV VE+ +LVIK++  + N           E+ W    Y  Y TR+ LPDN E EK++AE+KDGVLYITIPK      ++D+ +Q
Sbjct:  149 PGVSKEDVKVSVEDDVLVIKSDHREENGG---------EDCWSRKSYSCYDTRLKLPDNCEKEKVKAELKDGVLYITIPKTKIERTVIDVQIQ 232          

HSP 2 Score: 23.8682 bits (50), Expect = 8.863e-18
Identity = 7/18 (38.89%), Postives = 13/18 (72.22%), Query Frame = 1
Query:   34 RTPWAIRETENDYKIRLD 87
            R PW I++ E++ ++R D
Sbjct:  130 RVPWEIKDEEHEIRMRFD 147          
BLAST of BQ623194 vs. ExPASy Swiss-Prot
Match: HS22C_PETHY (Small heat shock protein, chloroplastic OS=Petunia hybrida GN=HSP22 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.487e-16
Identity = 41/93 (44.09%), Postives = 62/93 (66.67%), Query Frame = 2
Query:   92 PGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKIQAEVKDGVLYITIPKASSTAKIVDINVQ 370
            PG+S+ +VKV VE+ +LVIK E  ++ E+  D S       W  N Y SY TR++LPDNV+ +K++AE+K+GVL I+IPK     K+ D+ ++
Sbjct:  158 PGLSKEEVKVSVEDDVLVIKGEH-KKEESGKDDS-------WGRN-YSSYDTRLSLPDNVDKDKVKAELKNGVLLISIPKTKVEKKVTDVEIK 241          

HSP 2 Score: 26.5646 bits (57), Expect = 3.487e-16
Identity = 9/18 (50.00%), Postives = 13/18 (72.22%), Query Frame = 1
Query:   34 RTPWAIRETENDYKIRLD 87
            R PW I++ EN+ K+R D
Sbjct:  139 RAPWDIKDDENEIKMRFD 156          
BLAST of BQ623194 vs. ExPASy Swiss-Prot
Match: HS26P_ORYSJ (26.7 kDa heat shock protein, chloroplastic OS=Oryza sativa subsp. japonica GN=HSP26.7 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 8.223e-14
Identity = 37/93 (39.78%), Postives = 55/93 (59.14%), Query Frame = 2
Query:   92 PGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKIQAEVKDGVLYITIPKASSTAKIVDINVQ 370
            PG+SR +VKV VE+  LVI+ E  +      +GS    +  W      SY  R+ALPD  +  K++AE+K+GVL +T+PK     K++D+ VQ
Sbjct:  151 PGLSREEVKVMVEDDALVIRGEHKKEEGEGAEGSG---DGWWKERSVSSYDMRLALPDECDKSKVRAELKNGVLLVTVPKTEVERKVIDVQVQ 240          
BLAST of BQ623194 vs. ExPASy Swiss-Prot
Match: HS26M_ARATH (26.5 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP26.5 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.551e-12
Identity = 35/94 (37.23%), Postives = 61/94 (64.89%), Query Frame = 2
Query:   92 PGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKIQAEVKDGVLYITIPKASSTAK-IVDINVQ 370
            PG+++ DVK+ V + +L IK +    ++A  +  + EE+E W S  YG Y+T ++LPD+ + E I+AE+K+GVL + IP+     K + +I+V+
Sbjct:  143 PGLTKEDVKITVNDGILTIKGD----HKAEEEKGSPEEDEYWSSKSYGYYNTSLSLPDDAKVEDIKAELKNGVLNLVIPRTEKPKKNVQEISVE 232          
BLAST of BQ623194 vs. ExPASy Swiss-Prot
Match: HS21C_WHEAT (Small heat shock protein, chloroplastic OS=Triticum aestivum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.025e-12
Identity = 35/94 (37.23%), Postives = 57/94 (60.64%), Query Frame = 2
Query:   92 PGMSRNDVKVRVEESMLVIKAE-KAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKIQAEVKDGVLYITIPKASSTAKIVDINVQ 370
            PG+SR +V+V VE+  LVI+ E K +  E   +G     +  W      SY  R+ALPD  +  +++AE+K+GVL +++PK  +  K++D+ VQ
Sbjct:  149 PGLSREEVRVMVEDDALVIRGEHKKEAGEGQGEGG----DGWWKERSVSSYDMRLALPDECDKSQVRAELKNGVLLVSVPKRETERKVIDVQVQ 238          
The following BLAST results are available for this feature:
BLAST of BQ623194 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
HS22C_SOYBN1.850e-1848.39Small heat shock protein, chloroplastic (Fragment)... [more]
HS25P_ARATH2.386e-1841.9425.3 kDa heat shock protein, chloroplastic OS=Arab... [more]
HS21C_SOLLC8.859e-1844.57Small heat shock protein, chloroplastic OS=Solanum... [more]
HS21C_PEA8.863e-1845.16Small heat shock protein, chloroplastic OS=Pisum s... [more]
HS22C_PETHY3.487e-1644.09Small heat shock protein, chloroplastic OS=Petunia... [more]
HS26P_ORYSJ8.223e-1439.7826.7 kDa heat shock protein, chloroplastic OS=Oryz... [more]
HS26M_ARATH1.551e-1237.2326.5 kDa heat shock protein, mitochondrial OS=Arab... [more]
HS21C_WHEAT2.025e-1237.23Small heat shock protein, chloroplastic OS=Triticu... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00285 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00285 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623194 ID=BQ623194|Name=BQ623194|organism=Citrus sinensis|type=EST|length=541bp
CAAGAAAGGGTGAGAAGTGGATACAGACGGGGAAGAACGCCTTGGGCCAT
CAGGGAAACGGAAAACGACTACAAGATTAGGTTAGACGCTGCCTGGCATG
AGCAGGAATGATGTTAAGGTACGGGTTGAAGAGAGCATGCTCGTAATCAA
GGCAGAAAAGGCTCAAAGGAACGAAGCAAACACTGATGGAAGTACAGTTG
AGGAAGAAGAAGAGTGGCCAAGCAATGGTTACGGAAGCTACAGCACTAGA
ATTGCATTGCCTGACAACGTAGAGTTTGAGAAGATTCAAGCAGAGGTGAA
AGATGGCGTACTGTATATAACCATTCCAAAGGCCAGCTCCACCGCCAAAA
TCGTCGACATTAATGTCCAATAGGACAAGTATTCTGGTAACCCTCAAGTT
CCACATAGGACAAACCTAGATCTGCCCAGAGGAAGGTGGTGGGTAGAAAA
TAAGTGGCAGTAGGGTTAATTTGATTTCTTCATGTAATTTCAAACAGGAA
GGTTAGCGATATTATGTTAAGACTGTTCAAAACTTCTGCTA
back to top