BQ623196

Overview
NameBQ623196
Unique NameBQ623196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length541
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7321 contig Csv1_Contig7321:314..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623196 vs. ExPASy Swiss-Prot
Match: HIBCH_CHICK (3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Gallus gallus GN=HIBCH PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.298e-15
Identity = 41/95 (43.16%), Postives = 60/95 (63.16%), Query Frame = 3
Query:    3 SLKKASPTSLKISLRSIREGRLQGVGQCLIREYRMVCHVMMGEVSKDFFEGCRAILLDKDKNPKWKPSKLELVNDNMVDQYFSKINDDRWEDIKL 287
            ++ K SPTSLK++LR +REG    +      EYR+    M G    DF+EG RA+L+DKD++P+WKP+ LE V+D  VD  F  + ++   D+KL
Sbjct:  297 AINKMSPTSLKLTLRQLREGATMSLQDVFTMEYRLSQACMRGH---DFYEGVRAVLIDKDQSPRWKPAALEEVSDEFVDNCFKPLGNN---DLKL 385          
BLAST of BQ623196 vs. ExPASy Swiss-Prot
Match: HIBCH_DANRE (3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Danio rerio GN=hibch PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 7.331e-15
Identity = 42/95 (44.21%), Postives = 61/95 (64.21%), Query Frame = 3
Query:    3 SLKKASPTSLKISLRSIREGRLQGVGQCLIREYRMVCHVMMGEVSKDFFEGCRAILLDKDKNPKWKPSKLELVNDNMVDQYFSKINDDRWEDIKL 287
            +L K SPTSLK++ R I EG    + +  + EYR+    M G    DF+EG RA+L+DKD++PKWKPS L  V++  VD+ FS +++    D+KL
Sbjct:  294 TLAKMSPTSLKLTFRQIEEGARMSLQEVFMMEYRLSQACMNGH---DFYEGVRAVLIDKDQSPKWKPSTLAGVSEQFVDKCFSSLDE---RDLKL 382          
BLAST of BQ623196 vs. ExPASy Swiss-Prot
Match: HIBCH_BOVIN (3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Bos taurus GN=HIBCH PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 7.331e-15
Identity = 40/87 (45.98%), Postives = 57/87 (65.52%), Query Frame = 3
Query:    6 LKKASPTSLKISLRSIREGRLQGVGQCLIREYRMVCHVMMGEVSKDFFEGCRAILLDKDKNPKWKPSKLELVNDNMVDQYFSKINDD 266
            +KK SPTSLKI+LR + EG  + + + LI EYR+    M G    DF EG RA+L+DKD++PKWKP+ L+ V D  ++ YF  +  +
Sbjct:  299 IKKMSPTSLKITLRQLMEGSSKTLPEVLIMEYRLSQACMKGH---DFHEGVRAVLIDKDQSPKWKPADLKEVTDEDLNDYFKSLGSN 382          
BLAST of BQ623196 vs. ExPASy Swiss-Prot
Match: HIBCH_MOUSE (3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus GN=Hibch PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.752e-14
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 3
Query:    6 LKKASPTSLKISLRSIREGRLQGVGQCLIREYRMVCHVMMGEVSKDFFEGCRAILLDKDKNPKWKPSKLELVNDNMVDQYFSKI 257
            + K SPTSLKI+LR + EG  + + + LI EYR+    M G    DF EG RA+L+DKD+ PKWKP+ L+ V D  ++ YF  +
Sbjct:  298 INKMSPTSLKITLRQLMEGSSKTLQEVLIMEYRITQACMEGH---DFHEGVRAVLIDKDQTPKWKPANLKDVTDEDLNSYFKSL 378          
BLAST of BQ623196 vs. ExPASy Swiss-Prot
Match: HIBCH_XENTR (3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus tropicalis GN=hibch PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 6.206e-14
Identity = 40/95 (42.11%), Postives = 58/95 (61.05%), Query Frame = 3
Query:    3 SLKKASPTSLKISLRSIREGRLQGVGQCLIREYRMVCHVMMGEVSKDFFEGCRAILLDKDKNPKWKPSKLELVNDNMVDQYFSKINDDRWEDIKL 287
            +L   SPTSLKI+ R ++EG    + + L  EYR+    M G    DF+EG RA+L+DK++N KW P  LE V D+ +D YF+ + +    D+KL
Sbjct:  297 TLSTMSPTSLKITFRQLKEGSSMSLQEVLTMEYRLSQACMKGY---DFYEGVRAVLIDKNQNAKWNPELLEEVTDDYIDSYFTSLGN---SDLKL 385          
BLAST of BQ623196 vs. ExPASy Swiss-Prot
Match: HIBCH_RAT (3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Rattus norvegicus GN=Hibch PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 1.383e-13
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 3
Query:    6 LKKASPTSLKISLRSIREGRLQGVGQCLIREYRMVCHVMMGEVSKDFFEGCRAILLDKDKNPKWKPSKLELVNDNMVDQYFSKI 257
            + K SPTSLKI+LR + EG  + + + L  EYR+    M G    DF EG RA+L+DKD+ PKWKP+ L+ V D  ++ YF  +
Sbjct:  298 INKMSPTSLKITLRQLMEGSTKTLQEVLTMEYRLTQACMEGH---DFHEGVRAVLIDKDQTPKWKPADLKDVTDEDLNSYFKSL 378          
BLAST of BQ623196 vs. ExPASy Swiss-Prot
Match: HIBCH_XENLA (3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus laevis GN=hibch PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 4.023e-13
Identity = 39/95 (41.05%), Postives = 56/95 (58.95%), Query Frame = 3
Query:    3 SLKKASPTSLKISLRSIREGRLQGVGQCLIREYRMVCHVMMGEVSKDFFEGCRAILLDKDKNPKWKPSKLELVNDNMVDQYFSKINDDRWEDIKL 287
            +L   SPTSLKI+ R ++EG    + + L  EYR+    M G    DF+EG RA+L+DKD+  KWKP  LE V ++ +D  F+ +      D+KL
Sbjct:  297 TLSTMSPTSLKITFRQLKEGASMSLQEVLTMEYRLSQACMNGH---DFYEGVRAVLIDKDQKAKWKPESLEEVTEDYIDSCFTSLGS---RDLKL 385          
BLAST of BQ623196 vs. ExPASy Swiss-Prot
Match: HIBCH_DICDI (3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Dictyostelium discoideum GN=hibch PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.170e-12
Identity = 33/90 (36.67%), Postives = 58/90 (64.44%), Query Frame = 3
Query:    3 SLKKASPTSLKISLRSIREG-RLQGVGQCLIREYRMVCHVMMGEVSKDFFEGCRAILLDKDKNPKWKPSKLELVNDNMVDQYFSKINDDR 269
            +LK  SP+SL +    +++G +L  + +CL  E+R+  H +      DFFEG RA+L+DKDKNPKW P  ++ ++  +V+ YF  +++++
Sbjct:  291 TLKSVSPSSLMVVFEQMKQGAKLPSLAKCLEMEFRISQHFLE---KPDFFEGVRALLVDKDKNPKWLPPSIDQIDQTLVNSYFKPLSNNK 377          
BLAST of BQ623196 vs. ExPASy Swiss-Prot
Match: HIBCH_HUMAN (3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 1.529e-12
Identity = 36/84 (42.86%), Postives = 54/84 (64.29%), Query Frame = 3
Query:    6 LKKASPTSLKISLRSIREGRLQGVGQCLIREYRMVCHVMMGEVSKDFFEGCRAILLDKDKNPKWKPSKLELVNDNMVDQYFSKI 257
            + K SPTSLKI+LR + EG  + + + L  EYR+    M G    DF EG RA+L+DKD++PKWKP+ L+ V +  ++ +F  +
Sbjct:  299 INKMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGH---DFHEGVRAVLIDKDQSPKWKPADLKEVTEEDLNNHFKSL 379          
The following BLAST results are available for this feature:
BLAST of BQ623196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
HIBCH_CHICK4.298e-1543.163-hydroxyisobutyryl-CoA hydrolase, mitochondrial O... [more]
HIBCH_DANRE7.331e-1544.213-hydroxyisobutyryl-CoA hydrolase, mitochondrial O... [more]
HIBCH_BOVIN7.331e-1545.983-hydroxyisobutyryl-CoA hydrolase, mitochondrial O... [more]
HIBCH_MOUSE4.752e-1446.433-hydroxyisobutyryl-CoA hydrolase, mitochondrial O... [more]
HIBCH_XENTR6.206e-1442.113-hydroxyisobutyryl-CoA hydrolase, mitochondrial O... [more]
HIBCH_RAT1.383e-1345.243-hydroxyisobutyryl-CoA hydrolase, mitochondrial O... [more]
HIBCH_XENLA4.023e-1341.053-hydroxyisobutyryl-CoA hydrolase, mitochondrial O... [more]
HIBCH_DICDI1.170e-1236.673-hydroxyisobutyryl-CoA hydrolase, mitochondrial O... [more]
HIBCH_HUMAN1.529e-1242.863-hydroxyisobutyryl-CoA hydrolase, mitochondrial O... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00287 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00287 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623196 ID=BQ623196|Name=BQ623196|organism=Citrus sinensis|type=EST|length=541bp
AGTCCTTGAAGAAGGCGTCACCAACAAGTCTTAAAATTTCTCTTAGATCG
ATTAGAGAAGGGAGGCTGCAAGGTGTTGGTCAATGCCTTATTCGCGAGTA
TAGAATGGTCTGTCATGTCATGATGGGAGAAGTTAGCAAAGACTTCTTTG
AGGGTTGCAGAGCCATTCTATTAGACAAGGATAAGAACCCGAAGTGGAAG
CCGTCTAAATTGGAGCTAGTCAATGACAATATGGTTGACCAATATTTCTC
CAAGATCAATGATGACAGATGGGAAGATATAAAGCTGCCTGCTAGGTCGA
ACTTGCCCGCCACAGCCATTGCGAAGCTCTAAGTAATTGTGAGAATGAGT
TGGTATTGCTGCAGCTTGCTGCCATGCTTGCCTAACAGAATTTGTCCAAT
GGAAGTAGATGAAATCCTTGTCCGTTGCTGTTCTTTCAAACAAAATAAGG
ATTGAGCTTTGTTGATGCTTCTTTGTACCCCCTTCATAGTGTACAATACA
TGAGACTGTTTCGGCTCTGGCTTAAAAAAAAAAAAAAAAAA
back to top