BQ623201

Overview
NameBQ623201
Unique NameBQ623201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length538
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2300 contig Csv1_Contig2300:504..1041. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Match: NAT3_ARATH (Nucleobase-ascorbate transporter 3 OS=Arabidopsis thaliana GN=NAT3 PE=2 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 3.251e-71
Identity = 128/178 (71.91%), Postives = 146/178 (82.02%), Query Frame = 3
Query:    3 LFCIGVVWAFAAILTAAGAYNNVPEQTKLSCRTDRSYLLSSAPWIKVPYPFQWGTPIFRASHVFGMIGAALVTSAESTGTFIAASRFAGATAPPAHVLSRSIGLQGIGMLVEGIFGSLVGTTASVENVGLLGLTHIGSRRVVQISTAFMXXXXXXXXXXXXXXXIPLPIFAAIYCVLL 536
            L C+ ++WAFAAILT +GAYNNV   TK SCRTDR++L+SSAPWI++PYPFQWGTPIF+ASHVFGM GAA+V SAESTG F AASR AGATAPPAHV+SRSIGLQGIG+L+EGIFGS+ G TASVENVGLLGLT IGSRRVVQ+ST FM               IPLPIFA +YC+LL
Sbjct:  244 LVCLAIIWAFAAILTVSGAYNNVSTATKQSCRTDRAFLMSSAPWIRIPYPFQWGTPIFKASHVFGMFGAAIVASAESTGVFFAASRLAGATAPPAHVVSRSIGLQGIGVLLEGIFGSITGNTASVENVGLLGLTRIGSRRVVQVSTFFMIFFSIFGKFGAFFASIPLPIFAGVYCILL 421          
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Match: NAT4_ARATH (Nucleobase-ascorbate transporter 4 OS=Arabidopsis thaliana GN=NAT4 PE=2 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 2.117e-54
Identity = 104/177 (58.76%), Postives = 125/177 (70.62%), Query Frame = 3
Query:    3 LFCIGVVWAFAAILTAAGAYNNVPEQTKLSCRTDRSYLLSSAPWIKVPYPFQWGTPIFRASHVFGMIGAALVTSAESTGTFIAASRFAGATAPPAHVLSRSIGLQGIGMLVEGIFGSLVGTTASVENVGLLGLTHIGSRRVVQISTAFMXXXXXXXXXXXXXXXIPLPIFAAIYCVL 533
            LF I +VWA+A ILTAAGAY+  P+ T+LSCRTDRS L+S++PW+++PYP QWG P F  S  F M+ A  V   E+TG+FIAASRF  AT  P  VLSR IG QGIG+L+ G+FG+  G+TA VEN GLLGLT +GSRRVVQIS  FM               IPLPIFAA+YCVL
Sbjct:  220 LFTIAIVWAYAEILTAAGAYDKRPDNTQLSCRTDRSGLISASPWVRIPYPLQWGRPSFHGSDAFAMMAATYVAIVETTGSFIAASRFGSATHIPPSVLSRGIGWQGIGVLLNGLFGTATGSTALVENTGLLGLTKVGSRRVVQISAGFMIFFSIFGKFGAVLASIPLPIFAALYCVL 396          
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Match: NAT2_ARATH (Nucleobase-ascorbate transporter 2 OS=Arabidopsis thaliana GN=NAT2 PE=2 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 4.717e-54
Identity = 101/172 (58.72%), Postives = 123/172 (71.51%), Query Frame = 3
Query:   18 VVWAFAAILTAAGAYNNVPEQTKLSCRTDRSYLLSSAPWIKVPYPFQWGTPIFRASHVFGMIGAALVTSAESTGTFIAASRFAGATAPPAHVLSRSIGLQGIGMLVEGIFGSLVGTTASVENVGLLGLTHIGSRRVVQISTAFMXXXXXXXXXXXXXXXIPLPIFAAIYCVL 533
            +VWA+A +LTA+GAY + P QT+L+CRTD S L+SSAPWIK+PYP QWG P F A H F M+ A LV+  ESTG F AA+R A AT PP HVLSR IG QGIG+L+ G+FG+L G++ SVEN+GLLG T +GSRRV+QIS  FM               IP  IFAA+YCVL
Sbjct:  225 IVWAYAHVLTASGAYKHRPHQTQLNCRTDMSNLISSAPWIKIPYPLQWGAPSFDAGHAFAMMAAVLVSLIESTGAFKAAARLASATPPPPHVLSRGIGWQGIGILLNGLFGTLSGSSVSVENIGLLGSTRVGSRRVIQISAGFMIFFSMLGKFGALFASIPFTIFAAVYCVL 396          
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Match: NAT1_ARATH (Nucleobase-ascorbate transporter 1 OS=Arabidopsis thaliana GN=NAT1 PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 8.895e-53
Identity = 98/177 (55.37%), Postives = 124/177 (70.06%), Query Frame = 3
Query:    3 LFCIGVVWAFAAILTAAGAYNNVPEQTKLSCRTDRSYLLSSAPWIKVPYPFQWGTPIFRASHVFGMIGAALVTSAESTGTFIAASRFAGATAPPAHVLSRSIGLQGIGMLVEGIFGSLVGTTASVENVGLLGLTHIGSRRVVQISTAFMXXXXXXXXXXXXXXXIPLPIFAAIYCVL 533
            L C+ +VW +A ILTA+GAY   P  T+ SCRTD++ L+S+APW K PYP QWG P F   H F M+ A LV+  ESTG +IAASR A AT PPA+VLSR IG QGIG+L++G+FG+  G+T  VENVGLLGLT +GSRRVVQ+S  FM               IP+PI+AA++C+L
Sbjct:  216 LICVTIVWIYAVILTASGAYRGKPSLTQHSCRTDKANLISTAPWFKFPYPLQWGPPTFSVGHSFAMMSAVLVSMVESTGAYIAASRLAIATPPPAYVLSRGIGWQGIGVLLDGLFGTGTGSTVLVENVGLLGLTRVGSRRVVQVSAGFMIVFSTLGKFGAVFASIPVPIYAALHCIL 392          
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Match: NAT5_ARATH (Nucleobase-ascorbate transporter 5 OS=Arabidopsis thaliana GN=NAT5 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 4.569e-49
Identity = 92/176 (52.27%), Postives = 118/176 (67.05%), Query Frame = 3
Query:    3 LFCIGVVWAFAAILTAAGAYNNVPEQTKLSCRTDRSYLLSSAPWIKVPYPFQWGTPIFRASHVFGMIGAALVTSAESTGTFIAASRFAGATAPPAHVLSRSIGLQGIGMLVEGIFGSLVGTTASVENVGLLGLTHIGSRRVVQISTAFMXXXXXXXXXXXXXXXIPLPIFAAIYCV 530
            +F + +VW +A  LT  GAYN V   T+ SCRTDR+ L+S+APWI+VP+PFQWG P+F A   F M+ A+ V   ESTG FIA SR+A AT PP  V+SR +G QG+ +L+ G+FG+ +G++ SVEN GLL LT IGSRRVVQIS  FM               IP PI AA+YC+
Sbjct:  222 IFSVAIVWLYAFFLTLGGAYNGVGTDTQRSCRTDRAGLISAAPWIRVPWPFQWGAPLFDAGEAFAMMMASFVALVESTGAFIAVSRYASATMPPPSVISRGVGWQGVAILISGLFGTGIGSSVSVENAGLLALTKIGSRRVVQISAGFMIFFSILGKFGAVFASIPSPIIAALYCL 397          
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Match: NAT7_ARATH (Nucleobase-ascorbate transporter 7 OS=Arabidopsis thaliana GN=NAT7 PE=2 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 1.470e-47
Identity = 90/176 (51.14%), Postives = 115/176 (65.34%), Query Frame = 3
Query:    3 LFCIGVVWAFAAILTAAGAYNNVPEQTKLSCRTDRSYLLSSAPWIKVPYPFQWGTPIFRASHVFGMIGAALVTSAESTGTFIAASRFAGATAPPAHVLSRSIGLQGIGMLVEGIFGSLVGTTASVENVGLLGLTHIGSRRVVQISTAFMXXXXXXXXXXXXXXXIPLPIFAAIYCV 530
            +F + +VW +A +LT  GAY N    T+ SCRTDRS L+S +PWI+VPYPFQWG P F A   F M+  + V+  ESTGT+I  SRFA AT PP  VLSR +G QG+G+L+ G+FG+  G + SVEN GLL LT +GSRRVVQIS  FM               IP P+ AA++C+
Sbjct:  232 IFSVVIVWIYAHLLTVGGAYKNTGVNTQTSCRTDRSGLISGSPWIRVPYPFQWGPPTFHAGEAFAMMAVSFVSLIESTGTYIVVSRFASATPPPPSVLSRGVGWQGVGVLLCGLFGAGNGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAIFASIPAPVVAALHCL 407          
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Match: LPE1_MAIZE (Nucleobase-ascorbate transporter LPE1 OS=Zea mays GN=LPE1 PE=1 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 3.620e-46
Identity = 89/177 (50.28%), Postives = 116/177 (65.54%), Query Frame = 3
Query:    3 LFCIGVVWAFAAILTAAGAYNNVPEQTKLSCRTDRSYLLSSAPWIKVPYPFQWGTPIFRASHVFGMIGAALVTSAESTGTFIAASRFAGATAPPAHVLSRSIGLQGIGMLVEGIFGSLVGTTASVENVGLLGLTHIGSRRVVQISTAFMXXXXXXXXXXXXXXXIPLPIFAAIYCVL 533
            L  + ++W +A ILTAAGAYN     T+ SCR DRS ++  +PW++ PYPFQWG PIF     F M+ A+  +  ESTGT IA SR++GAT  P  V SR IG +GI ++++G+ G+L GT ASVEN GLL +T +GSRRV++IS  FM               IPLPIFAA+YCVL
Sbjct:  221 LVTVVIIWIYAEILTAAGAYNERGPVTQFSCRADRSGIIQGSPWVRFPYPFQWGYPIFCFQDCFAMLAASFASLIESTGTLIAVSRYSGATFCPPSVFSRGIGWEGISIILDGMCGTLTGTAASVENAGLLAVTRVGSRRVIKISALFMIFFSLFAKFGAVLASIPLPIFAALYCVL 397          
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Match: NAT6_ARATH (Nucleobase-ascorbate transporter 6 OS=Arabidopsis thaliana GN=NAT6 PE=2 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 4.728e-46
Identity = 86/176 (48.86%), Postives = 114/176 (64.77%), Query Frame = 3
Query:    3 LFCIGVVWAFAAILTAAGAYNNVPEQTKLSCRTDRSYLLSSAPWIKVPYPFQWGTPIFRASHVFGMIGAALVTSAESTGTFIAASRFAGATAPPAHVLSRSIGLQGIGMLVEGIFGSLVGTTASVENVGLLGLTHIGSRRVVQISTAFMXXXXXXXXXXXXXXXIPLPIFAAIYCV 530
            +F + +VW +A +LT  GAYN     T+ SCRTDR+ ++ +APWI+VP+PFQWG P F A   F M+ A+ V   ESTG F+A SR+A AT  P  +LSR IG QG+ +L+ G+FG+  G++ SVEN GLL LT +GSRRVVQI+  FM               IP PI AA+YC+
Sbjct:  226 IFAVVIVWIYAHLLTVGGAYNGAAPTTQTSCRTDRAGIIGAAPWIRVPWPFQWGAPSFDAGEAFAMMMASFVALVESTGAFVAVSRYASATMLPPSILSRGIGWQGVAILISGLFGTGAGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCL 401          
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Match: NAT8_ARATH (Nucleobase-ascorbate transporter 8 OS=Arabidopsis thaliana GN=NAT8 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 2.594e-44
Identity = 86/177 (48.59%), Postives = 118/177 (66.67%), Query Frame = 3
Query:    3 LFCIGVVWAFAAILTAAGAYNNVPEQTKLSCRTDRSYLLSSAPWIKVPYPFQWG-TPIFRASHVFGMIGAALVTSAESTGTFIAASRFAGATAPPAHVLSRSIGLQGIGMLVEGIFGSLVGTTASVENVGLLGLTHIGSRRVVQISTAFMXXXXXXXXXXXXXXXIPLPIFAAIYCV 530
            +F + +VW +A ILT  GAY+N    T++SCRTDR+ ++S++PWI+VP+P QWG  P F A  +F M+ A+ V+  ESTGT+IA SR+A AT  P  VLSR IG QG G+L+ G+FG+   T+ SVEN GLL +T +GSRRV+Q++  FM               IP PI AA+YC+
Sbjct:  232 IFSVVIVWLYAYILTIGGAYSNTEINTQISCRTDRAGIISASPWIRVPHPIQWGGAPTFNAGDIFAMMAASFVSLVESTGTYIAVSRYASATPIPPSVLSRGIGWQGFGILLCGLFGAGNATSVSVENAGLLAVTRVGSRRVIQVAAGFMIFFSILGKFGAIFASIPAPIVAALYCL 408          
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Match: NAT10_ARATH (Putative nucleobase-ascorbate transporter 10 OS=Arabidopsis thaliana GN=NAT10 PE=3 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 4.425e-44
Identity = 84/178 (47.19%), Postives = 116/178 (65.17%), Query Frame = 3
Query:    3 LFCIGVVWAFAAILTAAGAYNNVPEQTKLSCRTDRSYLLSSAPWIKVPYPFQWGTPIFRASHVFGMIGAALVTSAESTGTFIAASRFAGATAPPAHVLSRSIGLQGIGMLVEGIFGSLVGTTASVENVGLLGLTHIGSRRVVQISTAFMXXXXXXXXXXXXXXXIPLPIFAAIYCVLL 536
            + CI +VW FA +LT++G Y++    T+ SCRTDR+ L+++ PWI +PYPFQWG+P F  +  F M+ A+ VT  ESTG F A++R+  AT  P  V+SR     G+G+L+ G+ G + G T S ENVGLL +T IGSRRV+QIS AFM               IPLPI A++YC++L
Sbjct:  237 ILCIPLVWLFAQLLTSSGVYDHKSHTTQTSCRTDRTGLITNTPWIYIPYPFQWGSPTFDITDSFAMMAASFVTLFESTGLFYASARYGSATPIPPSVVSRGTCWLGVGVLLNGMLGGITGITTSTENVGLLAMTKIGSRRVIQISAAFMIFFSIFGKFGAFFASIPLPIMASLYCIVL 414          
The following BLAST results are available for this feature:
BLAST of BQ623201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
NAT3_ARATH3.251e-7171.91Nucleobase-ascorbate transporter 3 OS=Arabidopsis ... [more]
NAT4_ARATH2.117e-5458.76Nucleobase-ascorbate transporter 4 OS=Arabidopsis ... [more]
NAT2_ARATH4.717e-5458.72Nucleobase-ascorbate transporter 2 OS=Arabidopsis ... [more]
NAT1_ARATH8.895e-5355.37Nucleobase-ascorbate transporter 1 OS=Arabidopsis ... [more]
NAT5_ARATH4.569e-4952.27Nucleobase-ascorbate transporter 5 OS=Arabidopsis ... [more]
NAT7_ARATH1.470e-4751.14Nucleobase-ascorbate transporter 7 OS=Arabidopsis ... [more]
LPE1_MAIZE3.620e-4650.28Nucleobase-ascorbate transporter LPE1 OS=Zea mays ... [more]
NAT6_ARATH4.728e-4648.86Nucleobase-ascorbate transporter 6 OS=Arabidopsis ... [more]
NAT8_ARATH2.594e-4448.59Nucleobase-ascorbate transporter 8 OS=Arabidopsis ... [more]
NAT10_ARATH4.425e-4447.19Putative nucleobase-ascorbate transporter 10 OS=Ar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00292 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00292 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623201 ID=BQ623201|Name=BQ623201|organism=Citrus sinensis|type=EST|length=538bp
TGCTTTTCTGCATTGGAGTTGTTTGGGCTTTTGCTGCCATCCTCACTGCA
GCTGGTGCTTACAATAATGTTCCAGAGCAAACTAAACTGAGCTGCCGCAC
AGATCGTTCTTATCTTTTGTCTTCTGCTCCTTGGATTAAGGTTCCTTACC
CATTTCAGTGGGGTACTCCCATATTCAGAGCAAGCCATGTCTTTGGGATG
ATAGGAGCAGCACTTGTAACATCTGCAGAGTCAACTGGAACATTTATTGC
AGCATCACGGTTTGCAGGTGCTACAGCTCCTCCAGCACATGTCCTCAGCC
GAAGTATTGGCCTGCAGGGTATTGGCATGCTGGTTGAAGGAATTTTTGGT
TCTCTTGTTGGTACTACTGCATCTGTGGAAAATGTTGGCCTCCTCGGCCT
AACACACATAGGCAGCAGAAGAGTGGTGCAGATTTCAACTGCGTTCATGA
TATTTTTCTCCATATTTGGGAAGTTTGGTGCCTTCTTTGCATCCATTCCA
TTGCCAATATTTGCTGCCATATACTGTGTTCTATTAGG
back to top