BQ623202

Overview
NameBQ623202
Unique NameBQ623202
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length621
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6855 contig Csv1_Contig6855:17..637. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Match: PRU1_PRUAR (Major allergen Pru ar 1 OS=Prunus armeniaca PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.915e-42
Identity = 86/160 (53.75%), Postives = 109/160 (68.12%), Query Frame = 2
Query:   83 MGVLTLNAEETSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYETKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKAGLEKEKGIFKALEAYALANPNA 562
            MGV T   E TS +PPEKLFK F+L  D L+PKV P  VK  E++ GDGG G+IKK  F EG+ + Y KHRVD +DK+N  Y+YT I  EGDA    I++++Y+ K+V +PDGGS       ++ K   EIKEEQVKAG EK  G+FK +EAY LANP+A
Sbjct:    1 MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGEGSQYAYVKHRVDGIDKDNLSYSYTLI--EGDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDA 158          
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Match: PRU1_PRUAV (Major allergen Pru av 1 OS=Prunus avium GN=PRUA1 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 5.216e-40
Identity = 80/160 (50.00%), Postives = 108/160 (67.50%), Query Frame = 2
Query:   83 MGVLTLNAEETSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYETKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKAGLEKEKGIFKALEAYALANPNA 562
            MGV T  +E TS +PP +LFK FVL  D L+PK+ PQ +K+ E++ GDGGPG+IKK  F EG+ + Y KH++D++DKEN  Y+YT I  EGDA   T++ +SYETK+V +P GGS       ++ K   EIKEE VKAG EK   +FK +E Y   +P+A
Sbjct:    1 MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTLI--EGDALGDTLEKISYETKLVASPSGGSIIKSTSHYHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDA 158          
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Match: MAL12_MALDO (Major allergen Mal d 1 OS=Malus domestica PE=1 SV=3)

HSP 1 Score: 154.451 bits (389), Expect = 4.133e-37
Identity = 79/160 (49.38%), Postives = 106/160 (66.25%), Query Frame = 2
Query:   83 MGVLTLNAEETSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYETKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKAGLEKEKGIFKALEAYALANPNA 562
            MGV T   E TS +PP +LFK FVL  D L+PK+ PQ +K+ E++ GDGGPG+IKK  F EG+ + Y KH++D++D+ N  Y YT I  EGDA   TI+ VSYETK+V +   GS    +  ++ K   EIKEE VKAG EK  G+FK +E+Y   +P+A
Sbjct:    1 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLI--EGDALTDTIEKVSYETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDA 157          
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Match: MAL11_MALDO (Major allergen Mal d 1 OS=Malus domestica GN=MALD1 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 4.569e-36
Identity = 78/162 (48.15%), Postives = 107/162 (66.05%), Query Frame = 2
Query:   83 MGVLTLNAEETSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYETKVVGTPDGGSKSTV--VIKFYPKPGAEIKEEQVKAGLEKEKGIFKALEAYALANPNA 562
            MGV T   E TS +PP +LFK FVL  D L+PK+ PQ +K  E++ G+GGPG+IKK  F EG+ + Y KHR+D++D+ +  Y+YT I  EGDA   TI+ +SYETK+V     GS ST+  +  ++ K   EIKEE VK G EK  G+FK +E+Y   +P+A
Sbjct:    1 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLI--EGDALTDTIEKISYETKLVAC---GSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDA 157          
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Match: PYRC1_PYRCO (Major allergen Pyr c 1 OS=Pyrus communis GN=PYRC1 PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.736e-35
Identity = 78/162 (48.15%), Postives = 108/162 (66.67%), Query Frame = 2
Query:   83 MGVLTLNAEETSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYETKVVGTPDGGSKSTV--VIKFYPKPGAEIKEEQVKAGLEKEKGIFKALEAYALANPNA 562
            MG+ T   E TS +PP +LFK FVL  D L+PK+ PQ +K+ E++ G+GGPG+IKK  F EG+ + Y KHRVD++D+ +  Y YT I  EGDA   TI+ +SYE K+V +   GS ST+  +  ++ K   EIKEE VKAG EK  G+FK +E+Y   +P+A
Sbjct:    1 MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFGEGSQYGYVKHRVDSIDEASYSYAYTLI--EGDALTDTIEKISYEAKLVAS---GSGSTIKSISHYHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDA 157          
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Match: BEV1G_BETVE (Major pollen allergen Bet v 1-G OS=Betula verrucosa GN=BETV1G PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.295e-34
Identity = 76/162 (46.91%), Postives = 103/162 (63.58%), Query Frame = 2
Query:   83 MGVLTLNAEETSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEG--EGDANIPTIDHVSYETKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKAGLEKEKGIFKALEAYALANPNA 562
            MGV    +E TS +P  +LFK F+L  D L+PKV PQ + +VE I G+GGPG+IKK NF EG  +KY K RVD +D  N  YNY+ IEG   GD    T++ +S E K+V TPDGG    +  K++ K   E+K EQVKA  E  + + +A+E+Y LA+ +A
Sbjct:    1 MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGD----TLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDA 158          
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Match: BEV1D_BETVE (Major pollen allergen Bet v 1-D/H OS=Betula verrucosa GN=BETV1D PE=1 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 2.122e-33
Identity = 76/162 (46.91%), Postives = 102/162 (62.96%), Query Frame = 2
Query:   83 MGVLTLNAEETSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEG--EGDANIPTIDHVSYETKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKAGLEKEKGIFKALEAYALANPNA 562
            MGV     E TS +P  +LFK F+L  D L+PKV PQ + +VE I G+GGPG+IKK NF EG  +KY K RVD +D  N  YNY+ IEG   GD    T++ +S E K+V TPDGG    +  K++ K   E+K EQVKA  E  + + +A+E+Y LA+ +A
Sbjct:    1 MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGD----TLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDA 158          
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Match: BEV1L_BETVE (Major pollen allergen Bet v 1-L OS=Betula verrucosa GN=BETV1L PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 3.620e-33
Identity = 75/162 (46.30%), Postives = 102/162 (62.96%), Query Frame = 2
Query:   83 MGVLTLNAEETSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEG--EGDANIPTIDHVSYETKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKAGLEKEKGIFKALEAYALANPNA 562
            MGV     E TS +P  ++FK F+L  D L+PKV PQ + +VE I G+GGPG+IKK NF EG  +KY K RVD +D  N  YNY+ IEG   GD    T++ +S E K+V TPDGG    +  K++ K   E+K EQVKA  E  + + +A+E+Y LA+ +A
Sbjct:    1 MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGD----TLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDA 158          
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Match: BEV1A_BETVE (Major pollen allergen Bet v 1-A OS=Betula verrucosa GN=BETVIA PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 3.620e-33
Identity = 76/162 (46.91%), Postives = 102/162 (62.96%), Query Frame = 2
Query:   83 MGVLTLNAEETSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGE--GDANIPTIDHVSYETKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKAGLEKEKGIFKALEAYALANPNA 562
            MGV     E TS +P  +LFK F+L  D L PKV PQ + +VE I G+GGPG+IKK +F EG  +KY K RVD +D  N  YNY+ IEG   GD    T++ +S E K+V TPDGGS   +  K++ K   E+K EQVKA  E  + + +A+E+Y LA+ +A
Sbjct:    1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGD----TLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDA 158          
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Match: BEV1C_BETVE (Major pollen allergen Bet v 1-C OS=Betula verrucosa GN=BETV1C PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 1.053e-32
Identity = 73/160 (45.62%), Postives = 103/160 (64.38%), Query Frame = 2
Query:   83 MGVLTLNAEETSTLPPEKLFKLFVLHFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYETKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKAGLEKEKGIFKALEAYALANPNA 562
            MGV    +E TS +P  +LFK F+L  DTL+PKV PQ + +VE I G+GGPG+IKK  F EG+ +KY K RVD +D  N  Y+Y+ I  EG A   T++ +  E K+V TPDGGS   +  K++ K   E+K E +KA  EK + + +A+E+Y LA+ +A
Sbjct:    1 MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSMI--EGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDA 158          
The following BLAST results are available for this feature:
BLAST of BQ623202 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
PRU1_PRUAR1.915e-4253.75Major allergen Pru ar 1 OS=Prunus armeniaca PE=1 S... [more]
PRU1_PRUAV5.216e-4050.00Major allergen Pru av 1 OS=Prunus avium GN=PRUA1 P... [more]
MAL12_MALDO4.133e-3749.38Major allergen Mal d 1 OS=Malus domestica PE=1 SV=... [more]
MAL11_MALDO4.569e-3648.15Major allergen Mal d 1 OS=Malus domestica GN=MALD1... [more]
PYRC1_PYRCO1.736e-3548.15Major allergen Pyr c 1 OS=Pyrus communis GN=PYRC1 ... [more]
BEV1G_BETVE7.295e-3446.91Major pollen allergen Bet v 1-G OS=Betula verrucos... [more]
BEV1D_BETVE2.122e-3346.91Major pollen allergen Bet v 1-D/H OS=Betula verruc... [more]
BEV1L_BETVE3.620e-3346.30Major pollen allergen Bet v 1-L OS=Betula verrucos... [more]
BEV1A_BETVE3.620e-3346.91Major pollen allergen Bet v 1-A OS=Betula verrucos... [more]
BEV1C_BETVE1.053e-3245.63Major pollen allergen Bet v 1-C OS=Betula verrucos... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00293 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00293 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623202 ID=BQ623202|Name=BQ623202|organism=Citrus sinensis|type=EST|length=621bp
ATCACAATTCACTCAGAAAATTTCCCAATTTCAGTTGATCGATAGTTTTC
ATATTCTTTCTTTGTTTAACTCTTAGACAATCATGGGTGTTCTCACGTTG
AATGCAGAGGAAACAAGCACTCTCCCCCCTGAAAAGTTGTTCAAACTTTT
TGTCCTTCATTTCGACACCCTTCTGCCCAAAGTCCTGCCTCAGGTTGTAA
AGAACGTTGAATTGATTTCAGGGGATGGAGGCCCTGGAAGCATCAAGAAG
TTTAACTTTGTTGAAGGTGCTGATTGGAAGTACTTTAAGCATAGGGTTGA
TGCATTGGACAAAGAGAACAAGATATACAATTACACGGCAATTGAAGGTG
AGGGTGATGCTAACATCCCTACTATTGATCATGTTTCTTATGAGACTAAG
GTTGTGGGCACCCCTGACGGAGGAAGCAAGAGCACCGTTGTTATCAAGTT
CTATCCCAAACCAGGTGCCGAGATTAAGGAAGAGCAGGTTAAGGCAGGCT
TGGAAAAGGAGAAGGGAATTTTTAAGGCTCTGGAAGCCTATGCCTTGGCA
AACCCGAATGCCGTATAAGCTCTTACATCAACACTTCACCGCACTTGCGT
CGCCTTTGTTGCAACATTATG
back to top