BQ623203

Overview
NameBQ623203
Unique NameBQ623203
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length530
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5593 contig Csv1_Contig5593:28..555. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Match: RL37A_GOSHI (60S ribosomal protein L37a OS=Gossypium hirsutum GN=RPL37A PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.855e-39
Identity = 75/76 (98.68%), Postives = 75/76 (98.68%), Query Frame = 2
Query:  107 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 334
            RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCK CGKVKAGGAYTLNTASAVTVRSTIRRLREQTES
Sbjct:   17 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKACGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92          

HSP 2 Score: 28.4906 bits (62), Expect = 1.855e-39
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 1
Query:   70 TKKAGIVGKYGT 105
            TKKAGIVGKYGT
Sbjct:    5 TKKAGIVGKYGT 16          
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Match: RL37A_ORYSJ (60S ribosomal protein L37a OS=Oryza sativa subsp. japonica GN=Os01g0679700 PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 2.417e-39
Identity = 73/76 (96.05%), Postives = 76/76 (100.00%), Query Frame = 2
Query:  107 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 334
            RYGASLRKQIKKMEVSQHSKYFCEFCGK+AVKRKAVGIWGCKDCGKVKAGGAYT+NTASAVTVRSTIRRLREQTE+
Sbjct:   17 RYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCGKVKAGGAYTMNTASAVTVRSTIRRLREQTEA 92          

HSP 2 Score: 28.4906 bits (62), Expect = 2.417e-39
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 1
Query:   70 TKKAGIVGKYGT 105
            TKKAGIVGKYGT
Sbjct:    5 TKKAGIVGKYGT 16          
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Match: RL37A_PSEMZ (60S ribosomal protein L37a OS=Pseudotsuga menziesii GN=RPL37A PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.007e-38
Identity = 72/75 (96.00%), Postives = 74/75 (98.67%), Query Frame = 2
Query:  107 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTE 331
            RYGASLRKQIKKMEVSQHSK+FCEFCGK+AVKRKAVGIWGCKDCGKVKAGGAYTLNT SAVTVRSTIRRLREQTE
Sbjct:   17 RYGASLRKQIKKMEVSQHSKFFCEFCGKFAVKRKAVGIWGCKDCGKVKAGGAYTLNTPSAVTVRSTIRRLREQTE 91          

HSP 2 Score: 28.4906 bits (62), Expect = 2.007e-38
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 1
Query:   70 TKKAGIVGKYGT 105
            TKKAGIVGKYGT
Sbjct:    5 TKKAGIVGKYGT 16          
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Match: R37A1_ARATH (Putative 60S ribosomal protein L37a-1 OS=Arabidopsis thaliana GN=RPL37AB PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 4.440e-38
Identity = 72/76 (94.74%), Postives = 75/76 (98.68%), Query Frame = 2
Query:  107 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 334
            RYGASLRKQIKKMEVSQH+KYFCEFCGKY+VKRK VGIWGCKDCGKVKAGGAYT+NTASAVTVRSTIRRLREQTES
Sbjct:   17 RYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDCGKVKAGGAYTMNTASAVTVRSTIRRLREQTES 92          

HSP 2 Score: 25.409 bits (54), Expect = 4.440e-38
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 1
Query:   70 TKKAGIVGKYGT 105
            TKKA IVGKYGT
Sbjct:    5 TKKARIVGKYGT 16          
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Match: R37A2_ARATH (60S ribosomal protein L37a-2 OS=Arabidopsis thaliana GN=RPL37AC PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 7.537e-38
Identity = 71/75 (94.67%), Postives = 73/75 (97.33%), Query Frame = 2
Query:  107 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTE 331
            RYGAS+RKQIKKMEVSQHSKYFCEFCGKY VKRKAVGIWGCKDCGKVKAGGAYT+NTASAVTVRSTIRRLREQ E
Sbjct:   17 RYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDCGKVKAGGAYTMNTASAVTVRSTIRRLREQIE 91          

HSP 2 Score: 26.9498 bits (58), Expect = 7.537e-38
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 1
Query:   70 TKKAGIVGKYGT 105
            TKK GIVGKYGT
Sbjct:    5 TKKVGIVGKYGT 16          
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Match: RL37A_BRARA (60S ribosomal protein L37a OS=Brassica rapa GN=RPL37A PE=3 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 1.803e-36
Identity = 71/76 (93.42%), Postives = 73/76 (96.05%), Query Frame = 2
Query:  107 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRS-TIRRLREQTE 331
            RYGAS+RKQIKKMEVSQHSKYFCEFCGKY VKRKAVGIWGCKDCGKVKAGGAYT+NTASAVTVRS TIRRLREQ E
Sbjct:   17 RYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDCGKVKAGGAYTMNTASAVTVRSHTIRRLREQIE 92          

HSP 2 Score: 26.9498 bits (58), Expect = 1.803e-36
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 1
Query:   70 TKKAGIVGKYGT 105
            TKK GIVGKYGT
Sbjct:    5 TKKVGIVGKYGT 16          
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Match: RL37A_OSTLU (60S ribosomal protein L37a OS=Ostreococcus lucimarinus (strain CCE9901) GN=RPL37a PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.645e-31
Identity = 59/75 (78.67%), Postives = 65/75 (86.67%), Query Frame = 2
Query:  107 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTE 331
            RYGASLRK +KK EVSQHSK+FC+FCGKY +KRKAVGIW CK C K KAGGAY+LNT  +VTVRSTIRRLRE TE
Sbjct:   17 RYGASLRKVVKKQEVSQHSKFFCDFCGKYGMKRKAVGIWSCKGCNKTKAGGAYSLNTGGSVTVRSTIRRLREATE 91          

HSP 2 Score: 26.9498 bits (58), Expect = 2.645e-31
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 1
Query:   70 TKKAGIVGKYGT 105
            TKK GIVGKYGT
Sbjct:    5 TKKVGIVGKYGT 16          
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Match: RL37A_OSTTA (60S ribosomal protein L37a OS=Ostreococcus tauri GN=RPL37a PE=3 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 2.189e-30
Identity = 58/75 (77.33%), Postives = 65/75 (86.67%), Query Frame = 2
Query:  107 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTE 331
            RYGASLRK +KK EVSQHSK+FC+FCGKY +KR+AVGIW CK C K KAGGAY+LNT  +VTVRSTIRRLRE TE
Sbjct:   17 RYGASLRKVVKKTEVSQHSKFFCDFCGKYGMKRQAVGIWCCKGCNKTKAGGAYSLNTGGSVTVRSTIRRLREATE 91          

HSP 2 Score: 26.9498 bits (58), Expect = 2.189e-30
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 1
Query:   70 TKKAGIVGKYGT 105
            TKK GIVGKYGT
Sbjct:    5 TKKVGIVGKYGT 16          
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Match: RL37A_CRYST (60S ribosomal protein L37a OS=Cryptochiton stelleri GN=RPL37A PE=3 SV=3)

HSP 1 Score: 117.857 bits (294), Expect = 7.294e-28
Identity = 54/76 (71.05%), Postives = 64/76 (84.21%), Query Frame = 2
Query:  107 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 334
            RYGASLRK +KKME++QHSKY C+FCGK A+KR+AVGIWGCK C KV AGGA+  +T +AVTVRS +RRLRE  ES
Sbjct:   17 RYGASLRKTVKKMEITQHSKYTCQFCGKDAMKRQAVGIWGCKSCRKVVAGGAWVYSTMAAVTVRSAVRRLREMKES 92          

HSP 2 Score: 26.9498 bits (58), Expect = 7.294e-28
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 1
Query:   70 TKKAGIVGKYGT 105
            TKK GIVGKYGT
Sbjct:    5 TKKVGIVGKYGT 16          
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Match: RL37A_DICDI (60S ribosomal protein L37a OS=Dictyostelium discoideum GN=rpl37A PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.420e-25
Identity = 50/72 (69.44%), Postives = 59/72 (81.94%), Query Frame = 2
Query:  107 RYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLRE 322
            RYGASLRKQ+KKME++QH  Y C FCGK AV+R +VGIW C  C KV AGGA+T++TA+  TVRSTIRRLRE
Sbjct:   17 RYGASLRKQVKKMEITQHGTYTCSFCGKDAVRRSSVGIWKCNGCRKVLAGGAWTMSTAAGATVRSTIRRLRE 88          

HSP 2 Score: 26.5646 bits (57), Expect = 2.420e-25
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:   70 TKKAGIVGKYGT 105
            TKK G+VGKYGT
Sbjct:    5 TKKVGVVGKYGT 16          
The following BLAST results are available for this feature:
BLAST of BQ623203 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
RL37A_GOSHI1.855e-3998.6860S ribosomal protein L37a OS=Gossypium hirsutum G... [more]
RL37A_ORYSJ2.417e-3996.0560S ribosomal protein L37a OS=Oryza sativa subsp. ... [more]
RL37A_PSEMZ2.007e-3896.0060S ribosomal protein L37a OS=Pseudotsuga menziesi... [more]
R37A1_ARATH4.440e-3894.74Putative 60S ribosomal protein L37a-1 OS=Arabidops... [more]
R37A2_ARATH7.537e-3894.6760S ribosomal protein L37a-2 OS=Arabidopsis thalia... [more]
RL37A_BRARA1.803e-3693.4260S ribosomal protein L37a OS=Brassica rapa GN=RPL... [more]
RL37A_OSTLU2.645e-3178.6760S ribosomal protein L37a OS=Ostreococcus lucimar... [more]
RL37A_OSTTA2.189e-3077.3360S ribosomal protein L37a OS=Ostreococcus tauri G... [more]
RL37A_CRYST7.294e-2871.0560S ribosomal protein L37a OS=Cryptochiton steller... [more]
RL37A_DICDI2.420e-2569.4460S ribosomal protein L37a OS=Dictyostelium discoi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00294 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00294 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623203 ID=BQ623203|Name=BQ623203|organism=Citrus sinensis|type=EST|length=530bp
CGTCTCAAACAGCCGCTGCTTGTTGAAGAGCTACAGACCTTCGCTCCAAC
GCCACAATGACCAAGCTGTACGAAGAAGGCTGGAATCGTTGGAAAGTATG
GTACCCCGTTATGGTGCCAGTTTGAGGAAGCAAATTAAGAAGATGGAGGT
TAGTCAGCATAGCAAATATTTCTGCGAATTTTGCGGGAAGTATGCGGTGA
AGAGGAAAGCTGTTGGCATTTGGGGCTGCAAGGACTGTGGGAAAGTCAAG
GCAGGCGGTGCCTACACTTTGAACACTGCTAGTGCTGTGACTGTGAGGAG
CACAATCCGTAGGTTGAGGGAGCAAACTGAAAGCTGAGCTTGCCACCATT
GGCTTACTCCCGTGTCTTAGGTCGTTTGATCTTTAGTTTCGGATACAACC
TTAAATCATTTTTGATGTTGCTTTATTTCTAGATGCAAAACAATTGGTTG
TTGGAACATGAAACTTTTGGCTGTGTTTTGACTCTTGAGATGTTCATTCG
CTATTTTTCCTATGAAATTATGTTATCTAG
back to top