BQ623208

Overview
NameBQ623208
Unique NameBQ623208
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length578
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1944 contig Csv1_Contig1944:433..1009. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623208 vs. ExPASy Swiss-Prot
Match: PSBQ2_ARATH (Oxygen-evolving enhancer protein 3-2, chloroplastic OS=Arabidopsis thaliana GN=PSBQ2 PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 1.657e-42
Identity = 83/116 (71.55%), Postives = 100/116 (86.21%), Query Frame = 3
Query:   21 VKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 368
            +K+RF+IQPLSP           K+I+NVK  IDKKAWPYVQNDLRLRASYLRYDLNT+ISAKPK+EKQSLK+LT KLFQTI NLD+AA+ KS+P+AEKYY+ETVS+LN+VL+K+G
Sbjct:  115 LKDRFYIQPLSPTEAAARAKDSAKEIINVKSFIDKKAWPYVQNDLRLRASYLRYDLNTVISAKPKEEKQSLKDLTAKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLAKLG 230          
BLAST of BQ623208 vs. ExPASy Swiss-Prot
Match: PSBQ1_MAIZE (Oxygen-evolving enhancer protein 3-1, chloroplastic OS=Zea mays GN=PSBQ1 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 5.894e-40
Identity = 79/116 (68.10%), Postives = 94/116 (81.03%), Query Frame = 3
Query:   21 VKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 368
            +KERF++QPL P           +DI+N+K LIDKKAWPYVQNDLRLRASYLRYDL T+I++KPK+EK+SLK LTGKLF TI +LDHAAKIKSTPEAEKY+A T   L DVL+K+G
Sbjct:  102 LKERFYLQPLPPAEAAARVKTSAQDIINLKPLIDKKAWPYVQNDLRLRASYLRYDLKTVIASKPKEEKKSLKELTGKLFSTIDDLDHAAKIKSTPEAEKYFAATKDALGDVLAKLG 217          
BLAST of BQ623208 vs. ExPASy Swiss-Prot
Match: PSBQ2_MAIZE (Oxygen-evolving enhancer protein 3-2, chloroplastic OS=Zea mays GN=PSBQ2 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.313e-39
Identity = 78/116 (67.24%), Postives = 94/116 (81.03%), Query Frame = 3
Query:   21 VKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 368
            +KERF++QPL P           +DI+N+K LIDKKAWPYVQNDLRLRASYLRYDL T+I++KPK+EK+SLK LTGKLF TI +LDHAAK+KSTPEAEKY+A T   L DVL+K+G
Sbjct:   98 LKERFYLQPLPPAEAVARVKTSAQDIINLKPLIDKKAWPYVQNDLRLRASYLRYDLKTVIASKPKEEKKSLKELTGKLFSTIDDLDHAAKMKSTPEAEKYFAATKDALGDVLAKLG 213          
BLAST of BQ623208 vs. ExPASy Swiss-Prot
Match: PSBQ1_ARATH (Oxygen-evolving enhancer protein 3-1, chloroplastic OS=Arabidopsis thaliana GN=PSBQ1 PE=1 SV=3)

HSP 1 Score: 162.155 bits (409), Expect = 1.715e-39
Identity = 80/116 (68.97%), Postives = 95/116 (81.90%), Query Frame = 3
Query:   21 VKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 368
            +K+RF++QPL P           KDI+NVK LID+KAWPYVQNDLR +ASYLRYDLNTIIS+KPKDEK+SLK+LT KLF TI NLD+AAK KS  +AEKYYAETVS LN+VL+K+G
Sbjct:  109 LKDRFYLQPLPPTEAAARAKESAKDIINVKPLIDRKAWPYVQNDLRSKASYLRYDLNTIISSKPKDEKKSLKDLTTKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAKLG 224          
BLAST of BQ623208 vs. ExPASy Swiss-Prot
Match: PSBQ_SPIOL (Oxygen-evolving enhancer protein 3, chloroplastic OS=Spinacia oleracea GN=PSBQ PE=1 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 7.205e-38
Identity = 75/117 (64.10%), Postives = 92/117 (78.63%), Query Frame = 3
Query:   18 HVKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 368
            + K+RF++QPL P            +ILNVK+ ID+KAWP +QNDLRLRASYLRYDL T+ISAKPKDEK+SL+ LT KLF +I NLDHAAKIKS  EAEKYY +TVS +N+VL+K+G
Sbjct:  116 YTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG 232          
BLAST of BQ623208 vs. ExPASy Swiss-Prot
Match: PSBQ_ORYSJ (Oxygen-evolving enhancer protein 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os07g0544800 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.502e-35
Identity = 72/116 (62.07%), Postives = 90/116 (77.59%), Query Frame = 3
Query:   21 VKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 368
            ++ERF++QPL P           +DI+N+K LI+KK WP+V++DLRLRASYLRYDL T+I++KPKDEK+ LK+LTGKLF TI  LDHAAKIKS  EAEKYY  T S L DVL+K+G
Sbjct:  102 LRERFYLQPLPPAEAAARAKESAQDIINLKPLIEKKQWPFVRDDLRLRASYLRYDLKTVINSKPKDEKKGLKDLTGKLFATIDGLDHAAKIKSPEEAEKYYTLTKSALGDVLAKLG 217          
BLAST of BQ623208 vs. ExPASy Swiss-Prot
Match: PSBQ_ORYSI (Oxygen-evolving enhancer protein 3, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_025465 PE=1 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 1.502e-35
Identity = 72/116 (62.07%), Postives = 90/116 (77.59%), Query Frame = 3
Query:   21 VKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 368
            ++ERF++QPL P           +DI+N+K LI+KK WP+V++DLRLRASYLRYDL T+I++KPKDEK+ LK+LTGKLF TI  LDHAAKIKS  EAEKYY  T S L DVL+K+G
Sbjct:  102 LRERFYLQPLPPAEAAARAKESAQDIINLKPLIEKKQWPFVRDDLRLRASYLRYDLKTVINSKPKDEKKGLKDLTGKLFATIDGLDHAAKIKSPEEAEKYYTLTKSALGDVLAKLG 217          
BLAST of BQ623208 vs. ExPASy Swiss-Prot
Match: PSBQ_ONOVI (Oxygen-evolving enhancer protein 3, chloroplastic OS=Onobrychis viciifolia GN=PSBQ PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.833e-34
Identity = 75/117 (64.10%), Postives = 91/117 (77.78%), Query Frame = 3
Query:   21 VKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLK-NLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 368
            +KERF+IQPLSP           K+I+ VK+ ID+K      NDLRLRASYLRYDLNT+IS+KPK++KQSLK +  GKLFQ I NLD+AAK+KS P+AEKYYA+ VSTLNDVLSK+G
Sbjct:  115 LKERFYIQPLSPTEAAQRQRESAKEIVAVKKFIDQKLGHMFINDLRLRASYLRYDLNTVISSKPKEQKQSLKESSAGKLFQDIDNLDYAAKLKSAPQAEKYYADAVSTLNDVLSKIG 231          
The following BLAST results are available for this feature:
BLAST of BQ623208 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
PSBQ2_ARATH1.657e-4271.55Oxygen-evolving enhancer protein 3-2, chloroplasti... [more]
PSBQ1_MAIZE5.894e-4068.10Oxygen-evolving enhancer protein 3-1, chloroplasti... [more]
PSBQ2_MAIZE1.313e-3967.24Oxygen-evolving enhancer protein 3-2, chloroplasti... [more]
PSBQ1_ARATH1.715e-3968.97Oxygen-evolving enhancer protein 3-1, chloroplasti... [more]
PSBQ_SPIOL7.205e-3864.10Oxygen-evolving enhancer protein 3, chloroplastic ... [more]
PSBQ_ORYSJ1.502e-3562.07Oxygen-evolving enhancer protein 3, chloroplastic ... [more]
PSBQ_ORYSI1.502e-3562.07Oxygen-evolving enhancer protein 3, chloroplastic ... [more]
PSBQ_ONOVI2.833e-3464.10Oxygen-evolving enhancer protein 3, chloroplastic ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00299 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00299 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623208 ID=BQ623208|Name=BQ623208|organism=Citrus sinensis|type=EST|length=578bp
AAGAGACCTGGATCTGCCACGTGAAGGAGAGGTTCTTCATCCAACCACTT
AGTCCAGCCCAGGCAGCAGAGAGAGCAAAGGCGTCAGCAAAGGATATTCT
TAATGTCAAGGAATTAATAGACAAGAAGGCCTGGCCCTATGTTCAGAATG
ATCTCCGTCTCAGGGCCTCATACCTTCGCTATGACCTCAACACTATCATT
TCTGCTAAGCCCAAAGATGAGAAACAATCCCTCAAGAACCTCACTGGAAA
GCTCTTCCAGACCATCGGCAATCTTGACCATGCGGCAAAGATTAAGAGCA
CTCCTGAAGCAGAGAAATACTATGCGGAGACTGTATCTACCCTGAACGAT
GTTCTCTCCAAGGTTGGCTAAGCAGAATTAATATAATCTGATGTAAACTA
TATTTTTCATTTTGTGAGGCAACAACTTCTGTGAATTTTATTGCAAGCTG
GCGTTCCGCTCAAAGTATCGAGAATAATTTGTCCAGGGTGAAATGTCTAT
AATTTTAACTGCTAAGAAACTGGCAGGCAGGCCCTCAAATATGGAGCATC
AAAAAACAAACACAAAAGAAAATACAAC
back to top