BQ623209

Overview
NameBQ623209
Unique NameBQ623209
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2750 contig Csv1_Contig2750:50..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI1_SPOST (Protein translation factor SUI1 homolog OS=Sporobolus stapfianus PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 4.629e-47
Identity = 94/115 (81.74%), Postives = 99/115 (86.09%), Query Frame = 2
Query:  119 MSDFDIQVXXXXXXXXXXKAEDSGA--GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            MSD DIQ+           A DSGA  GSK+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIK+HGF
Sbjct:    1 MSDLDIQIPTAFDPFSEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI1_ORYSJ (Protein translation factor SUI1 homolog OS=Oryza sativa subsp. japonica GN=GOS2 PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 4.629e-47
Identity = 94/115 (81.74%), Postives = 99/115 (86.09%), Query Frame = 2
Query:  119 MSDFDIQVXXXXXXXXXXKAEDSGA--GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            MSD DIQ+           A DSGA  GSK+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIK+HGF
Sbjct:    1 MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI1_ORYSI (Protein translation factor SUI1 homolog OS=Oryza sativa subsp. indica GN=GOS2 PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 4.629e-47
Identity = 94/115 (81.74%), Postives = 99/115 (86.09%), Query Frame = 2
Query:  119 MSDFDIQVXXXXXXXXXXKAEDSGA--GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            MSD DIQ+           A DSGA  GSK+YVH+R+QQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIK+HGF
Sbjct:    1 MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI1_SALBA (Protein translation factor SUI1 homolog OS=Salix bakko PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.759e-46
Identity = 90/113 (79.65%), Postives = 100/113 (88.50%), Query Frame = 2
Query:  119 MSDFDIQVXXXXXXXXXXKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            MS+FD  +           AEDSGAG+K+YVH+RVQQRNGRKSLTTVQGLKK++SYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKE+IK+HGF
Sbjct:    1 MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKDYSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKENIKIHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI1_MAIZE (Protein translation factor SUI1 homolog OS=Zea mays GN=TIF PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.759e-46
Identity = 93/115 (80.87%), Postives = 99/115 (86.09%), Query Frame = 2
Query:  119 MSDFDIQVXXXXXXXXXXKAEDSGA--GSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            MSD DIQ+           A DSGA  GSK+YVH+R+QQRNGRKSLTTVQGLKKEFSY+KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIK+HGF
Sbjct:    1 MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF 115          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI12_ARATH (Protein translation factor SUI1 homolog 2 OS=Arabidopsis thaliana GN=At1g54290 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.759e-46
Identity = 91/113 (80.53%), Postives = 100/113 (88.50%), Query Frame = 2
Query:  119 MSDFDIQVXXXXXXXXXXKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            MSD ++QV           AEDSGAG+KEYVHIRVQQRNGRKSLTTVQGLKKE+SY+KILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IK+HGF
Sbjct:    1 MSDLEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI11_ARATH (Protein translation factor SUI1 homolog 1 OS=Arabidopsis thaliana GN=At4g27130 PE=2 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 8.729e-46
Identity = 91/113 (80.53%), Postives = 98/113 (86.73%), Query Frame = 2
Query:  119 MSDFDIQVXXXXXXXXXXKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            MS+ D QV           AEDSGAG+KEYVHIRVQQRNGRKSLTTVQGLKKE+SY KILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IK+HGF
Sbjct:    1 MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI1_BRAOL (Protein translation factor SUI1 homolog OS=Brassica oleracea PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 4.332e-45
Identity = 90/113 (79.65%), Postives = 97/113 (85.84%), Query Frame = 2
Query:  119 MSDFDIQVXXXXXXXXXXKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            MS+ D QV           AEDSGAG+KEYVHIRVQQRNGRKSLTTVQGLKKE+SY KILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK+ I++HGF
Sbjct:    1 MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDDIQIHGF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: SUI1_PIMBR (Protein translation factor SUI1 homolog OS=Pimpinella brachycarpa PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.034e-38
Identity = 79/113 (69.91%), Postives = 89/113 (78.76%), Query Frame = 2
Query:  119 MSDFDIQVXXXXXXXXXXKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            M D DIQ+          +  D+   +KEYVHIR+QQRNGRKSLTTVQGLKKE SY+KILKDLKK  CCNGTVV D ELG+VIQLQGDQRKNVSTF+VQAGIVKK+ IK+H F
Sbjct:    1 MVDSDIQIPTSFDPFAEAEITDATGSTKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKILKDLKKALCCNGTVVNDKELGKVIQLQGDQRKNVSTFIVQAGIVKKDQIKVHNF 113          
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Match: EIF1B_PIG (Eukaryotic translation initiation factor 1b OS=Sus scrofa GN=EIF1B PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 7.424e-29
Identity = 54/89 (60.67%), Postives = 75/89 (84.27%), Query Frame = 2
Query:  191 AGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF 457
            AG+++Y+HIR+QQRNGRK+LTTVQG+  ++   K++K  KK+F CNGTV++ PE G+VIQLQGDQRKN+  FL++ GIVK+E +K+HGF
Sbjct:   25 AGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113          
The following BLAST results are available for this feature:
BLAST of BQ623209 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
SUI1_SPOST4.629e-4781.74Protein translation factor SUI1 homolog OS=Sporobo... [more]
SUI1_ORYSJ4.629e-4781.74Protein translation factor SUI1 homolog OS=Oryza s... [more]
SUI1_ORYSI4.629e-4781.74Protein translation factor SUI1 homolog OS=Oryza s... [more]
SUI1_SALBA1.759e-4679.65Protein translation factor SUI1 homolog OS=Salix b... [more]
SUI1_MAIZE1.759e-4680.87Protein translation factor SUI1 homolog OS=Zea may... [more]
SUI12_ARATH1.759e-4680.53Protein translation factor SUI1 homolog 2 OS=Arabi... [more]
SUI11_ARATH8.729e-4680.53Protein translation factor SUI1 homolog 1 OS=Arabi... [more]
SUI1_BRAOL4.332e-4579.65Protein translation factor SUI1 homolog OS=Brassic... [more]
SUI1_PIMBR1.034e-3869.91Protein translation factor SUI1 homolog OS=Pimpine... [more]
EIF1B_PIG7.424e-2960.67Eukaryotic translation initiation factor 1b OS=Sus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00300 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00300 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623209 ID=BQ623209|Name=BQ623209|organism=Citrus sinensis|type=EST|length=557bp
TCCGATTTAGGGTTTCTTTTTGATCTTATCAGATCGGACTATCTCGATTA
TTAAACCCTAATCTTCGGATCAGGTCTGAGCATTCCGGTTGTTGGGCCCC
TTGCATCAGCTGAGGTTCATGTCTGATTTTGATATCCAGGTTCCTGCTGC
CTTTGACCCGTTTGCTGATGCAAAGGCTGAGGACTCAGGTGCTGGTTCAA
AAGAGTATGTGCATATCCGTGTTCAGCAACGGAATGGTAGGAAAAGCCTG
ACAACTGTCCAGGGGTTGAAGAAAGAATTTAGTTACAACAAAATCCTCAA
GGACCTCAAAAAGGAATTTTGCTGCAATGGAACAGTGGTCCAGGATCCTG
AACTAGGACAGGTCATTCAACTCCAAGGTGACCAGCGGAAGAATGTATCT
ACGTTCCTTGTTCAGGCTGGGATTGTGAAGAAGGAACATATCAAAATGCA
TGGCTTTTAAGTAAACAGCAACTTCCGTTTCTGCACATTTGGTGACCCGC
GTTCGTCAGTGCAGTGCAGAACATGCTATTGATACTATTAAAAAAAAAAA
AAAAAAA
back to top