BQ623237

Overview
NameBQ623237
Unique NameBQ623237
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length566
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2295 contig Csv1_Contig2295:42..607. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623237 vs. ExPASy Swiss-Prot
Match: PSBR_ARATH (Photosystem II 10 kDa polypeptide, chloroplastic OS=Arabidopsis thaliana GN=PSBR PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 4.075e-46
Identity = 95/128 (74.22%), Postives = 103/128 (80.47%), Query Frame = 1
Query:   49 KPAPFTVGKSAARGLPSL--AKTSFKIVAKG-GKIKTDKPYGINGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 423
            KPA FTV K+AARGLPSL  A+ SFKIVA G  KIKTDKP+GING MDLR+G+DASGRK KG GVY++VDKYGANVDGYSPIYNEN+WS SGDVY GG TGLAIWAVT           VYNTSALAQ
Sbjct:   13 KPAGFTVEKTAARGLPSLTRARPSFKIVASGVKKIKTDKPFGINGSMDLRDGVDASGRKGKGYGVYKYVDKYGANVDGYSPIYNENEWSASGDVYKGGVTGLAIWAVTLAGILAGGALLVYNTSALAQ 140          
BLAST of BQ623237 vs. ExPASy Swiss-Prot
Match: PSBR_TOBAC (Photosystem II 10 kDa polypeptide, chloroplastic OS=Nicotiana tabacum GN=PSBR PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 9.079e-46
Identity = 91/128 (71.09%), Postives = 103/128 (80.47%), Query Frame = 1
Query:   49 KPAPFTVGKSAARGLPSLAKTS--FKIVAKG-GKIKTDKPYGINGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 423
            KPAPF+V K+A +GLPSLA++S  F++ A G  K+KTDKPYGING M LR+G+DASGRK KGKGVYQFVDKYGANVDGYSPIYN +DWSPSGDVY GG TGLAIWAVT           V+NTSALAQ
Sbjct:    9 KPAPFSVEKTAVKGLPSLARSSSSFRVQASGVKKLKTDKPYGINGSMSLRDGVDASGRKQKGKGVYQFVDKYGANVDGYSPIYNTDDWSPSGDVYVGGTTGLAIWAVTLVGILAGGALLVFNTSALAQ 136          
BLAST of BQ623237 vs. ExPASy Swiss-Prot
Match: PSBR_BRACM (Photosystem II 10 kDa polypeptide, chloroplastic OS=Brassica campestris GN=PSBR PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.712e-44
Identity = 91/129 (70.54%), Postives = 102/129 (79.07%), Query Frame = 1
Query:   49 KPAPFTVGKSAARGLPSLAK---TSFKIVAKG-GKIKTDKPYGINGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 423
            KPA FTV K +ARGLPSL +   +SF+IVA G  KIKTDKP+G+NG MDLR+G+DASGRK KG GVY+FVDKYGANVDGYSPIYNE++WS SGDVY GG TGLAIWAVT           VYNTSALAQ
Sbjct:   13 KPAGFTVEKMSARGLPSLTRASPSSFRIVASGVKKIKTDKPFGVNGSMDLRDGVDASGRKGKGYGVYKFVDKYGANVDGYSPIYNEDEWSASGDVYKGGVTGLAIWAVTLAGILAGGALLVYNTSALAQ 141          
BLAST of BQ623237 vs. ExPASy Swiss-Prot
Match: PSBR_SOLTU (Photosystem II 10 kDa polypeptide, chloroplastic OS=Solanum tuberosum GN=PSBR PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 2.472e-43
Identity = 87/124 (70.16%), Postives = 100/124 (80.65%), Query Frame = 1
Query:   61 FTVGKSAARGLPSLAKTS--FKIVAKG-GKIKTDKPYGINGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 423
            FT+ K++ +GLPSLA++S  FK+VA G  K+KTDKPYGING M LR+G+DASGRK KGKGVYQ+VDKYGANVDGYSPIYN ++WSPSGDVY GG TGLAIWAVT           VYNTSALAQ
Sbjct:   15 FTLEKTSVKGLPSLARSSSSFKVVASGVKKLKTDKPYGINGSMALRDGVDASGRKPKGKGVYQYVDKYGANVDGYSPIYNTDEWSPSGDVYVGGTTGLAIWAVTLVGILAGGALLVYNTSALAQ 138          
BLAST of BQ623237 vs. ExPASy Swiss-Prot
Match: PSBR_SOLLC (Photosystem II 10 kDa polypeptide, chloroplastic OS=Solanum lycopersicum GN=PSBR PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.603e-42
Identity = 86/124 (69.35%), Postives = 98/124 (79.03%), Query Frame = 1
Query:   61 FTVGKSAARGLPSLAKTS--FKIVAKG-GKIKTDKPYGINGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 423
            FT+ K + +GLPSL ++S  FK+VA G  K+KTDKPYGING M LR+G+DASGRK KGKGVYQ+VDKYGANVDGYSPIYN ++WSPSGDVY GG TGLAIWAVT           VYNTSALAQ
Sbjct:   15 FTLEKISVKGLPSLTRSSSSFKVVASGVKKLKTDKPYGINGSMALRDGVDASGRKPKGKGVYQYVDKYGANVDGYSPIYNTDEWSPSGDVYVGGTTGLAIWAVTLLGILAGGALLVYNTSALAQ 138          
BLAST of BQ623237 vs. ExPASy Swiss-Prot
Match: PSBR_SPIOL (Photosystem II 10 kDa polypeptide, chloroplastic OS=Spinacia oleracea GN=PSBR PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.829e-39
Identity = 84/129 (65.12%), Postives = 96/129 (74.42%), Query Frame = 1
Query:   49 KPAPFTVG-KSAARGLPSLAKTS--FKIVAKG-GKIKTDKPYGINGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 423
            KP+ F V  KSA +GLPSL+++S  F + A G  KIK DKP GI GGM LR+G+D+SGRK  GKGVYQFVDKYGANVDGYSPIYNE +W+P+GDVY GG TGL IWAVT           VYNTSALAQ
Sbjct:   12 KPSSFGVDTKSAVKGLPSLSRSSASFTVRASGVKKIKVDKPLGIGGGMKLRDGVDSSGRKPTGKGVYQFVDKYGANVDGYSPIYNEEEWAPTGDVYAGGTTGLLIWAVTLAGLLAGGALLVYNTSALAQ 140          
BLAST of BQ623237 vs. ExPASy Swiss-Prot
Match: PSBR_HORVU (Photosystem II 10 kDa polypeptide, chloroplastic OS=Hordeum vulgare GN=PSBR PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.273e-31
Identity = 69/117 (58.97%), Postives = 81/117 (69.23%), Query Frame = 1
Query:   73 KSAARGLPSLAKTSFKIVAKGGK-IKTDKPYGINGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALA 420
            +S   G+   A+ S  IVAK  K ++T +PYG  GG+  +EG+DASGR AKGKGVYQF DKYGANVDGYSPIY   +WSPSGDVY GG TGL +WAVT           VY+TSALA
Sbjct:   21 RSKLGGVRPSARPSLVIVAKKAKKVQTAQPYGPGGGVAFKEGVDASGRVAKGKGVYQFADKYGANVDGYSPIYTPEEWSPSGDVYVGGKTGLFLWAVTLAGILLGGALLVYSTSALA 137          
The following BLAST results are available for this feature:
BLAST of BQ623237 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
PSBR_ARATH4.075e-4674.22Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_TOBAC9.079e-4671.09Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_BRACM1.712e-4470.54Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_SOLTU2.472e-4370.16Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_SOLLC1.603e-4269.35Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_SPIOL2.829e-3965.12Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_HORVU1.273e-3158.97Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00328 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00328 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623237 ID=BQ623237|Name=BQ623237|organism=Citrus sinensis|type=EST|length=566bp
ACAGCAAAGCAAATGGCAGCCTCAGTGATGGCTTCTTCGTTGAGCCTGAA
ACCAGCTCCTTTCACTGTGGGGAAATCAGCAGCGAGAGGCCTTCCCTCTC
TTGCTAAAACTTCATTCAAAATTGTGGCTAAAGGCGGCAAGATCAAAACC
GACAAACCCTATGGAATAAATGGTGGTATGGATTTGAGGGAAGGTCTTGA
TGCATCCGGCAGGAAGGCTAAGGGGAAAGGTGTTTACCAATTTGTTGACA
AATACGGTGCCAATGTTGATGGATACAGTCCTATCTACAACGAGAATGAC
TGGTCTCCCAGTGGTGATGTCTATACTGGTGGTGCAACTGGCTTGGCAAT
CTGGGCTGTTACTCTTGCCGGTCTTCTTGCAGGAGGAGCACTTCTCGTCT
ACAACACAAGTGCTTTGGCACAGTAGATGAATTTCAATCAATGTTACATT
ATTATCTCTATTTTTTATAACTTGTCAATGTTGCTGTTAAATGTACCTTC
CACAGCTACTTCGTGTATCTATTTTGTGTAATGTTTTGGGTGGATTTAAA
TTGAGACATATAGCCA
back to top