BQ623239

Overview
NameBQ623239
Unique NameBQ623239
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length636
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig14 contig Csv1_Contig14:1..636. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623239 vs. ExPASy Swiss-Prot
Match: UFC1_DICDI (Probable Ufm1-conjugating enzyme 1 OS=Dictyostelium discoideum GN=ufc1 PE=3 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.454e-56
Identity = 94/130 (72.31%), Postives = 113/130 (86.92%), Query Frame = 2
Query:    2 YKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPILVDSGMIKHKDD 391
            Y+ALI Y ++NK  DNDWF I + NP GTRW GKCWY++N  KYEFDL+FD+PVTYP TAPE+ +P+LDGKT+KMYRGGKICLT+HFKPLW++N P FGIAHAL LGLAPWLAAE+P LVD+G+IKHK+D
Sbjct:   35 YQALIKYVEINKKADNDWFNIES-NPLGTRWQGKCWYIYNFKKYEFDLEFDMPVTYPETAPEIAIPELDGKTEKMYRGGKICLTIHFKPLWSRNVPHFGIAHALALGLAPWLAAEVPHLVDNGIIKHKED 163          
BLAST of BQ623239 vs. ExPASy Swiss-Prot
Match: UFC1_BOVIN (Ufm1-conjugating enzyme 1 OS=Bos taurus GN=UFC1 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.332e-53
Identity = 88/132 (66.67%), Postives = 110/132 (83.33%), Query Frame = 2
Query:    2 YKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPILVDSGMIKHKDDVS 397
            Y++LI Y + NK+ DNDWFR+ + N EGTRW GKCWY+H+LLKYEFD++FDIP+TYP TAPE+ +P+LDGKT KMYRGGKICLT HFKPLWA+N P+FG+AH + LGL PWLA EIP L+  G+I+HK+  S
Sbjct:   36 YQSLIRYVENNKNADNDWFRLES-NKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCS 166          
BLAST of BQ623239 vs. ExPASy Swiss-Prot
Match: UFC1_HUMAN (Ufm1-conjugating enzyme 1 OS=Homo sapiens GN=UFC1 PE=1 SV=3)

HSP 1 Score: 206.838 bits (525), Expect = 7.390e-53
Identity = 87/129 (67.44%), Postives = 109/129 (84.50%), Query Frame = 2
Query:    2 YKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPILVDSGMIKHKD 388
            Y++LI Y + NK+ DNDWFR+ + N EGTRW GKCWY+H+LLKYEFD++FDIP+TYP TAPE+ +P+LDGKT KMYRGGKICLT HFKPLWA+N P+FG+AH + LGL PWLA EIP L+  G+I+HK+
Sbjct:   36 YQSLIRYVENNKNADNDWFRLES-NKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKE 163          
BLAST of BQ623239 vs. ExPASy Swiss-Prot
Match: UFC1_MOUSE (Ufm1-conjugating enzyme 1 OS=Mus musculus GN=Ufc1 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.150e-52
Identity = 85/132 (64.39%), Postives = 110/132 (83.33%), Query Frame = 2
Query:    2 YKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPILVDSGMIKHKDDVS 397
            Y++LI Y + NK++DNDWFR+ + N EGTRW GKCWY+H+ LKYEFD++F+IP+TYP TAPE+ +P+LDGKT KMYRGGKICLT HFKPLWA+N P+FG+AH + LGL PWLA E+P L+  G+I+HK+  S
Sbjct:   36 YQSLIRYVENNKNSDNDWFRLES-NKEGTRWFGKCWYIHDFLKYEFDIEFEIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEVPDLIQKGVIQHKEKCS 166          
BLAST of BQ623239 vs. ExPASy Swiss-Prot
Match: UFC1_RAT (Ufm1-conjugating enzyme 1 OS=Rattus norvegicus GN=Ufc1 PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 8.171e-52
Identity = 84/129 (65.12%), Postives = 108/129 (83.72%), Query Frame = 2
Query:    2 YKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPILVDSGMIKHKD 388
            Y++LI Y + NK+ DNDWFR+ + N EGTRW GKCWY+H+ LKYEFD++F+IP+TYP TAPE+ +P+LDGKT KMYRGGKICLT HFKPLWA+N P+FG+AH + LGL PWLA E+P L+  G+I+HK+
Sbjct:   36 YQSLIRYVENNKNADNDWFRLES-NKEGTRWFGKCWYIHDFLKYEFDIEFEIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEVPDLIQKGVIQHKE 163          
BLAST of BQ623239 vs. ExPASy Swiss-Prot
Match: UFC1_CAEEL (Probable Ufm1-conjugating enzyme OS=Caenorhabditis elegans GN=C40H1.6 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.906e-49
Identity = 83/128 (64.84%), Postives = 104/128 (81.25%), Query Frame = 2
Query:    2 YKALIAYTQMNKSNDNDWFRISAANPEGTRWTGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICLTVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPILVDSGMIKHK 385
            Y+A+IA  Q NK  D DWF++ + N  GT+W GKCWY HN++KYEFD++FDIP+TYP TAPE+ LP+LDGKT KMYRGGKICL+ HFKPLWA+N P+FGIAHA  LGL PW+A EIP L++ G+I+ K
Sbjct:   35 YEAIIAAVQNNKDCDRDWFQLES-NERGTKWFGKCWYFHNMVKYEFDVEFDIPITYPVTAPEIALPELDGKTAKMYRGGKICLSEHFKPLWARNTPKFGIAHAFALGLGPWMAVEIPDLIEKGLIQPK 161          
The following BLAST results are available for this feature:
BLAST of BQ623239 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
UFC1_DICDI2.454e-5672.31Probable Ufm1-conjugating enzyme 1 OS=Dictyosteliu... [more]
UFC1_BOVIN4.332e-5366.67Ufm1-conjugating enzyme 1 OS=Bos taurus GN=UFC1 PE... [more]
UFC1_HUMAN7.390e-5367.44Ufm1-conjugating enzyme 1 OS=Homo sapiens GN=UFC1 ... [more]
UFC1_MOUSE2.150e-5264.39Ufm1-conjugating enzyme 1 OS=Mus musculus GN=Ufc1 ... [more]
UFC1_RAT8.171e-5265.12Ufm1-conjugating enzyme 1 OS=Rattus norvegicus GN=... [more]
UFC1_CAEEL2.906e-4964.84Probable Ufm1-conjugating enzyme OS=Caenorhabditis... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00330 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00330 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623239 ID=BQ623239|Name=BQ623239|organism=Citrus sinensis|type=EST|length=636bp
GTACAAGGCTTTGATCGCCTATACACAGATGAATAAGTCCAACGACAACG
ATTGGTTTCGCATCTCAGCGGCCAATCCGGAGGGGACACGTTGGACAGGC
AAGTGCTGGTACGTTCACAACCTCTTAAAGTACGAATTCGATCTCCAGTT
TGATATTCCGGTTACGTACCCCGCCACGGCCCCCGAGCTTGAGCTCCCCC
AACTCGATGGCAAGACCCAGAAGATGTACAGAGGAGGGAAGATTTGCTTG
ACCGTACATTTCAAGCCACTTTGGGCTAAAAACTGTCCTAGGTTTGGTAT
AGCACATGCACTTTGTCTTGGTCTTGCTCCATGGCTTGCAGCAGAGATTC
CCATTCTTGTTGATTCCGGAATGATTAAGCACAAAGATGATGTGAGCGGA
TCTAGTGAGTCTTAGTTAGTTAATGTAACATTAAGACTGTAAAAGGAATG
ATGATTTTTCGAATTCTTGATTTGGTCATATAAAATAAGTGCCAAGGCAA
GCAAGTGTGCAATTTACAAGATGCACTATTATGCATTTTTCTGGAAAATG
TTAATTACCATTATATTATTAGTTTTATAAATGTAACTTGTACCATTTTC
AGTTTTGAATACATTTACGTGATGAGTTGTCAAAAA
back to top