BQ623251

Overview
NameBQ623251
Unique NameBQ623251
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length546
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Match: PP390_ARATH (Pentatricopeptide repeat-containing protein At5g16860 OS=Arabidopsis thaliana GN=PCMP-H92 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.676e-51
Identity = 95/168 (56.55%), Postives = 117/168 (69.64%), Query Frame = 2
Query:   38 RVMFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGM 541
            R MFD+++PK RDV TWTVMIG YSQ+G AN AL L  +MF++D   +PNAFT                G+QIHAY LRNQ   +  FV+NCLIDMY++ G I  AR+VFDN+  +N V+WTSLMTGYGMHG G++A   FD+MR+ G   DGVT L +LYACSHSGM
Sbjct:  427 RAMFDSLSPKERDVVTWTVMIGGYSQHGDANKALELLSEMFEEDCQTRPNAFTISCALVACASLAALRIGKQIHAYALRNQQNAVPLFVSNCLIDMYAKCGSISDARLVFDNMMAKNEVTWTSLMTGYGMHGYGEEALGIFDEMRRIGFKLDGVTLLVVLYACSHSGM 594          

HSP 2 Score: 25.7942 bits (55), Expect = 1.676e-51
Identity = 10/12 (83.33%), Postives = 10/12 (83.33%), Query Frame = 1
Query:    1 DMYAKCKSVDVA 36
            DMYAKCK VD A
Sbjct:  415 DMYAKCKKVDTA 426          

HSP 3 Score: 83.1889 bits (204), Expect = 8.911e-16
Identity = 46/157 (29.30%), Postives = 82/157 (52.23%), Query Frame = 2
Query:   74 DVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGMG 544
            DV +W  +I SY++ G    AL +F +M  +    +P+  T                G+Q+H + + ++    + FV NCL+DMY++ G +D A  VF N+  ++VVSW +++ GY   G  + A   F++M++E +  D VT+   +   +  G+G
Sbjct:  192 DVVSWNSIIESYAKLGKPKVALEMFSRMTNEFGC-RPDNITLVNVLPPCASLGTHSLGKQLHCFAVTSEMIQNM-FVGNCLVDMYAKCGMMDEANTVFSNMSVKDVVSWNAMVAGYSQIGRFEDAVRLFEKMQEEKIKMDVVTWSAAISGYAQRGLG 346          

HSP 4 Score: 82.4185 bits (202), Expect = 1.520e-15
Identity = 53/162 (32.72%), Postives = 79/162 (48.77%), Query Frame = 2
Query:   74 DVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIP------FVANCLIDMYSRSGDIDTARVVFDNL--KQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEG--LAPDGVTFLGLLYACS 529
            DV TW+  I  Y+Q G   +AL +  QM      +KPN  T                G++IH Y ++   ++          V N LIDMY++   +DTAR +FD+L  K+R+VV+WT ++ GY  HG  +KA     +M +E     P+  T    L AC+
Sbjct:  329 DVVTWSAAISGYAQRGLGYEALGVCRQMLSSG--IKPNEVTLISVLSGCASVGALMHGKEIHCYAIKYPIDLRKNGHGDENMVINQLIDMYAKCKKVDTARAMFDSLSPKERDVVTWTVMIGGYSQHGDANKALELLSEMFEEDCQTRPNAFTISCALVACA 488          

HSP 5 Score: 70.4774 bits (171), Expect = 5.977e-12
Identity = 51/160 (31.87%), Postives = 68/160 (42.50%), Query Frame = 2
Query:   62 PKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKE-GLAPDGVTFLGLLYACSHSG 538
            P +  V  W  +I SY  NG AN  L LF  M        P+ +T                G   HA  L   +   + FV N L+ MYSR   +  AR VFD +   +VVSW S++  Y   G    A   F +M  E G  PD +T + +L  C+  G
Sbjct:   87 PSDAGVYHWNSLIRSYGDNGCANKCLYLFGLMHSLSWT--PDNYTFPFVFKACGEISSVRCGESAHALSLVTGFISNV-FVGNALVAMYSRCRSLSDARKVFDEMSVWDVVSWNSIIESYAKLGKPKVALEMFSRMTNEFGCRPDNITLVNVLPPCASLG 243          
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Match: PP320_ARATH (Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.505e-29
Identity = 63/157 (40.13%), Postives = 98/157 (62.42%), Query Frame = 2
Query:   71 RDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGM 541
            +D+ +W  +IG YS+N  AN+AL+LF  +  ++K   P+  T                GR+IH Y++RN Y      VAN L+DMY++ G +  A ++FD++  +++VSWT ++ GYGMHG G +A   F+QMR+ G+  D ++F+ LLYACSHSG+
Sbjct:  461 KDIISWNTIIGGYSKNCYANEALSLF-NLLLEEKRFSPDERTVACVLPACASLSAFDKGREIHGYIMRNGY-FSDRHVANSLVDMYAKCGALLLAHMLFDDIASKDLVSWTVMIAGYGMHGFGKEAIALFNQMRQAGIEADEISFVSLLYACSHSGL 615          

HSP 2 Score: 20.4014 bits (41), Expect = 2.505e-29
Identity = 8/12 (66.67%), Postives = 9/12 (75.00%), Query Frame = 1
Query:    1 DMYAKCKSVDVA 36
            DMYAKC S+  A
Sbjct:  440 DMYAKCGSMQEA 451          

HSP 3 Score: 90.1225 bits (222), Expect = 7.290e-18
Identity = 53/164 (32.32%), Postives = 85/164 (51.83%), Query Frame = 2
Query:   38 RVMFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACS 529
            R +FD +    RDV +W  +I  Y  NG A   L++F QM      ++ +  T                GR +H+  ++  +     F  N L+DMYS+ GD+D+A+ VF  +  R+VVS+TS++ GY   GL  +A   F++M +EG++PD  T   +L  C+
Sbjct:  250 RKVFDEMT--ERDVISWNSIINGYVSNGLAEKGLSVFVQMLVSG--IEIDLATIVSVFAGCADSRLISLGRAVHSIGVKACFSREDRF-CNTLLDMYSKCGDLDSAKAVFREMSDRSVVSYTSMIAGYAREGLAGEAVKLFEEMEEEGISPDVYTVTAVLNCCA 408          

HSP 4 Score: 75.8702 bits (185), Expect = 1.423e-13
Identity = 42/155 (27.10%), Postives = 85/155 (54.84%), Query Frame = 2
Query:   68 NRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKE-GLAPDGVTFLGLLYACS 529
            +R V ++T MI  Y++ G A +A+ LF +M  +++ + P+ +T                G+++H ++  N     I FV+N L+DMY++ G +  A +VF  ++ ++++SW +++ GY  +   ++A   F+ + +E   +PD  T   +L AC+
Sbjct:  359 DRSVVSYTSMIAGYAREGLAGEAVKLFEEM--EEEGISPDVYTVTAVLNCCARYRLLDEGKRVHEWIKENDLGFDI-FVSNALMDMYAKCGSMQEAELVFSEMRVKDIISWNTIIGGYSKNCYANEALSLFNLLLEEKRFSPDERTVACVLPACA 510          

HSP 5 Score: 72.7886 bits (177), Expect = 1.204e-12
Identity = 39/150 (26.00%), Postives = 76/150 (50.67%), Query Frame = 2
Query:   86 WTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHS 535
            W +++   +++G  + ++ LF +M      V+ +++T                G Q+H ++L++ +      V N L+  Y ++  +D+AR VFD + +R+V+SW S++ GY  +GL +K    F QM   G+  D  T + +   C+ S
Sbjct:  163 WNILMNELAKSGDFSGSIGLFKKMMSSG--VEMDSYTFSCVSKSFSSLRSVHGGEQLHGFILKSGFGERNS-VGNSLVAFYLKNQRVDSARKVFDEMTERDVISWNSIINGYVSNGLAEKGLSVFVQMLVSGIEIDLATIVSVFAGCADS 309          
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Match: PP252_ARATH (Pentatricopeptide repeat-containing protein At3g24000, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H87 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.199e-28
Identity = 64/168 (38.10%), Postives = 102/168 (60.71%), Query Frame = 2
Query:   38 RVMFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGM 541
            +++FDA+  +N DV+ W  +I  +++  G   AL LF  M +     +P+ F+                G+ +HAY++++  E L+ F  N L+DMY++SG I  AR +FD L +R+VVSW SL+T Y  HG G +A W F++MR+ G+ P+ ++FL +L ACSHSG+
Sbjct:  216 QLVFDALESRN-DVS-WNALIAGHARRSGTEKALELFQGMLRDG--FRPSHFSYASLFGACSSTGFLEQGKWVHAYMIKSG-EKLVAFAGNTLLDMYAKSGSIHDARKIFDRLAKRDVVSWNSLLTAYAQHGFGKEAVWWFEEMRRVGIRPNEISFLSVLTACSHSGL 378          

HSP 2 Score: 90.5077 bits (223), Expect = 5.582e-18
Identity = 52/156 (33.33%), Postives = 79/156 (50.64%), Query Frame = 2
Query:   71 RDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSG 538
            RD  TWT +I  YSQ+    DAL  F QM +      PN FT                G Q+H + ++  ++  +  V + L+D+Y+R G +D A++VFD L+ RN VSW +L+ G+      +KA   F  M ++G  P   ++  L  ACS +G
Sbjct:  124 RDFVTWTTLISGYSQHDRPCDALLFFNQMLRFG--YSPNEFTLSSVIKAAAAERRGCCGHQLHGFCVKCGFDSNV-HVGSALLDLYTRYGLMDDAQLVFDALESRNDVSWNALIAGHARRSGTEKALELFQGMLRDGFRPSHFSYASLFGACSSTG 276          
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Match: PP246_ARATH (Pentatricopeptide repeat-containing protein At3g22150, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E95 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.015e-27
Identity = 60/166 (36.14%), Postives = 97/166 (58.43%), Query Frame = 2
Query:   44 MFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGM 541
            +F+      RD ATW  MI  Y+QNG       +F +M +Q+  ++PNA T                G+Q+H + +R   +  + FVA+ L+DMYS++G I  A  +F   K+RN V++T+++ GYG HG+G++A   F  M++ G+ PD +TF+ +L ACS+SG+
Sbjct:  475 LFEGSGYAERDQATWNSMISGYTQNGHTEKTFLVFRKMLEQN--IRPNAVTVASILPACSQIGSVDLGKQLHGFSIRQYLDQNV-FVASALVDMYSKAGAIKYAEDMFSQTKERNSVTYTTMILGYGQHGMGERAISLFLSMQESGIKPDAITFVAVLSACSYSGL 637          

HSP 2 Score: 78.5666 bits (192), Expect = 2.195e-14
Identity = 51/165 (30.91%), Postives = 84/165 (50.91%), Query Frame = 2
Query:   38 RVMFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSH 532
            R +FD+   +N +V  W  MIG Y QN    +++ LF +     ++V     T                GRQ H +V +N  E+ I  V N L+ MYSR G +  +  VF ++++R+VVSW ++++ +  +GL D+      +M+K+G   D +T   LL A S+
Sbjct:  271 RRVFDSCVERNIEV--WNTMIGVYVQNDCLVESIELFLEAIGSKEIVSDEV-TYLLAASAVSALQQVELGRQFHGFVSKNFRELPIVIV-NSLMVMYSRCGSVHKSFGVFLSMRERDVVSWNTMISAFVQNGLDDEGLMLVYEMQKQGFKIDYITVTALLSAASN 431          

HSP 3 Score: 77.411 bits (189), Expect = 4.890e-14
Identity = 49/165 (29.70%), Postives = 86/165 (52.12%), Query Frame = 2
Query:   56 IAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRN--QYEMLIPFVANCLIDMYSRSGDIDTARVVFD--NLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSG 538
            ++ + RDV +W  MI ++ QNG  ++ L L  +M +Q    K +  T                G+Q HA+++R   Q+E +  +    LIDMYS+SG I  ++ +F+     +R+  +W S+++GY  +G  +K    F +M ++ + P+ VT   +L ACS  G
Sbjct:  377 LSMRERDVVSWNTMISAFVQNGLDDEGLMLVYEMQKQG--FKIDYITVTALLSAASNLRNKEIGKQTHAFLIRQGIQFEGMNSY----LIDMYSKSGLIRISQKLFEGSGYAERDQATWNSMISGYTQNGHTEKTFLVFRKMLEQNIRPNAVTVASILPACSQIG 535          
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Match: PP265_ARATH (Pentatricopeptide repeat-containing protein At3g46790, chloroplastic OS=Arabidopsis thaliana GN=CRR2 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.857e-27
Identity = 60/157 (38.22%), Postives = 91/157 (57.96%), Query Frame = 2
Query:   71 RDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGM 541
            R+V +W+ MI  Y++NG A +AL  F +M ++ K   PN+ T                G+ IH Y+LR   + ++P V + L+ MY R G ++  + VFD +  R+VVSW SL++ YG+HG G KA   F++M   G +P  VTF+ +L ACSH G+
Sbjct:  246 RNVVSWSAMIACYAKNGKAFEALRTFREMMRETKDSSPNSVTMVSVLQACASLAALEQGKLIHGYILRRGLDSILP-VISALVTMYGRCGKLEVGQRVFDRMHDRDVVSWNSLISSYGVHGYGKKAIQIFEEMLANGASPTPVTFVSVLGACSHEGL 401          
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Match: PPR32_ARATH (Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.102e-26
Identity = 59/159 (37.11%), Postives = 93/159 (58.49%), Query Frame = 2
Query:   65 KNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGM 541
            ++R + +W  MI  ++QNG   DAL  F QM  + + VKP+ FT                 + IH  V+R+  +  + FV   L+DMY++ G I  AR++FD + +R+V +W +++ GYG HG G  A   F++M+K  + P+GVTFL ++ ACSHSG+
Sbjct:  399 QSRTLVSWNAMILGFAQNGRPIDALNYFSQM--RSRTVKPDTFTYVSVITAIAELSITHHAKWIHGVVMRSCLDKNV-FVTTALVDMYAKCGAIMIARLIFDMMSERHVTTWNAMIDGYGTHGFGKAALELFEEMQKGTIKPNGVTFLSVISACSHSGL 554          

HSP 2 Score: 21.9422 bits (45), Expect = 3.102e-26
Identity = 8/11 (72.73%), Postives = 8/11 (72.73%), Query Frame = 1
Query:    4 MYAKCKSVDVA 36
            MY KCK VD A
Sbjct:  381 MYCKCKEVDTA 391          

HSP 3 Score: 102.834 bits (255), Expect = 1.087e-21
Identity = 54/167 (32.34%), Postives = 93/167 (55.69%), Query Frame = 2
Query:   38 RVMFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSG 538
            R +FD +    RD+ +W  ++  YSQNG A  AL +   M +++  +KP+  T                G++IH Y +R+ ++ L+  ++  L+DMY++ G ++TAR +FD + +RNVVSW S++  Y  +    +A   F +M  EG+ P  V+ +G L+AC+  G
Sbjct:  190 RKVFDRMP--ERDLVSWNTIVAGYSQNGMARMALEMVKSMCEEN--LKPSFITIVSVLPAVSALRLISVGKEIHGYAMRSGFDSLVN-ISTALVDMYAKCGSLETARQLFDGMLERNVVSWNSMIDAYVQNENPKEAMLIFQKMLDEGVKPTDVSVMGALHACADLG 351          

HSP 4 Score: 74.3294 bits (181), Expect = 6.533e-14
Identity = 48/162 (29.63%), Postives = 78/162 (48.15%), Query Frame = 2
Query:   38 RVMFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYA 523
            R +FD +  +N  V +W  MI +Y QN    +A+ +F +M   D+ VKP   +                GR IH   +    +  +  V N LI MY +  ++DTA  +F  L+ R +VSW +++ G+  +G    A   F QMR   + PD  T++ ++ A
Sbjct:  291 RQLFDGMLERN--VVSWNSMIDAYVQNENPKEAMLIFQKML--DEGVKPTDVSVMGALHACADLGDLERGRFIHKLSVELGLDRNVS-VVNSLISMYCKCKEVDTAASMFGKLQSRTLVSWNAMILGFAQNGRPIDALNYFSQMRSRTVKPDTFTYVSVITA 447          

HSP 5 Score: 21.9422 bits (45), Expect = 6.533e-14
Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 1
Query:    1 DMYAKCKSVDVA 36
            DMYAKC S++ A
Sbjct:  279 DMYAKCGSLETA 290          
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Match: PP251_ARATH (Putative pentatricopeptide repeat-containing protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32 PE=3 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 5.569e-26
Identity = 60/157 (38.22%), Postives = 91/157 (57.96%), Query Frame = 2
Query:   71 RDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGM 541
            RD  +W  ++  Y QNG  N+AL LF QM      VKP A                  G+Q+H YVLR  +   I F+A+ L+DMYS+ G+I  AR +FD +   + VSWT+++ G+ +HG G +A   F++M+++G+ P+ V F+ +L ACSH G+
Sbjct:  306 RDGISWNSLVAGYVQNGRYNEALRLFRQMVTAK--VKPGAVAFSSVIPACAHLATLHLGKQLHGYVLRGGFGSNI-FIASALVDMYSKCGNIKAARKIFDRMNVLDEVSWTAIIMGHALHGHGHEAVSLFEEMKRQGVKPNQVAFVAVLTACSHVGL 459          

HSP 2 Score: 84.3445 bits (207), Expect = 4.000e-16
Identity = 48/154 (31.17%), Postives = 82/154 (53.25%), Query Frame = 2
Query:   71 RDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSH 532
            +DV ++  +I  Y+Q+G   DAL +  +M   D  +KP++FT                G++IH YV+R   +  + ++ + L+DMY++S  I+ +  VF  L  R+ +SW SL+ GY  +G  ++A   F QM    + P  V F  ++ AC+H
Sbjct:  205 KDVVSYNTIIAGYAQSGMYEDALRMVREMGTTD--LKPDSFTLSSVLPIFSEYVDVIKGKEIHGYVIRKGIDSDV-YIGSSLVDMYAKSARIEDSERVFSRLYCRDGISWNSLVAGYVQNGRYNEALRLFRQMVTAKVKPGAVAFSSVIPACAH 355          
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Match: PP371_ARATH (Pentatricopeptide repeat-containing protein At5g08510 OS=Arabidopsis thaliana GN=PCMP-E20 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.241e-25
Identity = 68/167 (40.72%), Postives = 94/167 (56.29%), Query Frame = 2
Query:   44 MFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNL-KQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGM 541
            +FD++  KN  V +WT +I  +SQNG  ++AL +F  M ++DK VKPN  T                GR++  Y   N +   I +V N  I+MYS+ G ID A+ +F+ L  QRN+ SW S++     HG  D+A   F QM +EG  PD VTF+GLL AC H GM
Sbjct:  170 LFDSMPRKN--VTSWTTVISGFSQNGNYSEALKMFLCM-EKDKSVKPNHITVVSVLPACANLGELEIGRRLEGYARENGFFDNI-YVCNATIEMYSKCGMIDVAKRLFEELGNQRNLCSWNSMIGSLATHGKHDEALTLFAQMLREGEKPDAVTFVGLLLACVHGGM 332          
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Match: PP296_ARATH (Pentatricopeptide repeat-containing protein At3g63370 OS=Arabidopsis thaliana GN=PCMP-H83 PE=2 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 1.620e-25
Identity = 60/166 (36.14%), Postives = 100/166 (60.24%), Query Frame = 2
Query:   44 MFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGM 541
            +F++I  K +DV +WT MI S + NG  ++A+ LF +M +    +  ++                  GR+IH Y+LR  +  L   +A  ++DMY+  GD+ +A+ VFD ++++ ++ +TS++  YGMHG G  A   FD+MR E ++PD ++FL LLYACSH+G+
Sbjct:  543 VFESI--KGKDVVSWTSMISSSALNGNESEAVELFRRMVETG--LSADSVALLCILSAAASLSALNKGREIHCYLLRKGF-CLEGSIAVAVVDMYACCGDLQSAKAVFDRIERKGLLQYTSMINAYGMHGCGKAAVELFDKMRHENVSPDHISFLALLYACSHAGL 703          

HSP 2 Score: 69.707 bits (169), Expect = 1.020e-11
Identity = 46/162 (28.40%), Postives = 73/162 (45.06%), Query Frame = 2
Query:   38 RVMFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYA 523
            R +FD    K  D   W  ++ SYS +G + + L LF +M        PN++T                G++IHA VL++       +V N LI MY+R G +  A  +   +   +VV+W SL+ GY  + +  +A   F  M   G   D V+   ++ A
Sbjct:  237 RRLFDGFQEKG-DAVLWNSILSSYSTSGKSLETLELFREMHMTGPA--PNSYTIVSALTACDGFSYAKLGKEIHASVLKSSTHSSELYVCNALIAMYTRCGKMPQAERILRQMNNADVVTWNSLIKGYVQNLMYKEALEFFSDMIAAGHKSDEVSMTSIIAA 395          

HSP 3 Score: 66.6254 bits (161), Expect = 8.631e-11
Identity = 42/154 (27.27%), Postives = 81/154 (52.60%), Query Frame = 2
Query:   68 NRDVATWTVMIGSYSQNGGANDALALFPQMFQQDKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACS 529
            ++D+ +WT +I  Y+QN    +AL LF  + +  K ++ +                    ++IH ++LR    +L   + N L+D+Y +  ++  A  VF+++K ++VVSWTS+++   ++G   +A   F +M + GL+ D V  L +L A +
Sbjct:  449 DKDLISWTTVIAGYAQNDCHVEALELFRDVAK--KRMEIDEMILGSILRASSVLKSMLIVKEIHCHILRKG--LLDTVIQNELVDVYGKCRNMGYATRVFESIKGKDVVSWTSMISSSALNGNESEAVELFRRMVETGLSADSVALLCILSAAA 598          
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Match: PP267_ARATH (Pentatricopeptide repeat-containing protein At3g47530 OS=Arabidopsis thaliana GN=PCMP-H76 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.116e-25
Identity = 66/167 (39.52%), Postives = 95/167 (56.89%), Query Frame = 2
Query:   44 MFDAIAPKNRDVATWTVMIGSYSQNGGANDALALFPQMFQQ-DKLVKPNAFTXXXXXXXXXXXXXXXFGRQIHAYVLRNQYEMLIPFVANCLIDMYSRSGDIDTARVVFDNLKQRNVVSWTSLMTGYGMHGLGDKAHWAFDQMRKEGLAPDGVTFLGLLYACSHSGM 541
            +FD I PK RD  +W V+   Y +N    D L LF +M    D  VKP+  T               FG+Q+H ++  N     +  ++N L+ MYSR G +D A  VF  +++RNVVSWT+L++G  M+G G +A  AF++M K G++P+  T  GLL ACSHSG+
Sbjct:  170 VFDEI-PK-RDTVSWNVLFSCYLRNKRTRDVLVLFDKMKNDVDGCVKPDGVTCLLALQACANLGALDFGKQVHDFIDENGLSGALN-LSNTLVSMYSRCGSMDKAYQVFYGMRERNVVSWTALISGLAMNGFGKEAIEAFNEMLKFGISPEEQTLTGLLSACSHSGL 333          
The following BLAST results are available for this feature:
BLAST of BQ623251 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 190
Match NameE-valueIdentityDescription
PP390_ARATH1.676e-5156.55Pentatricopeptide repeat-containing protein At5g16... [more]
PP320_ARATH2.505e-2940.13Pentatricopeptide repeat-containing protein At4g18... [more]
PP252_ARATH1.199e-2838.10Pentatricopeptide repeat-containing protein At3g24... [more]
PP246_ARATH1.015e-2736.14Pentatricopeptide repeat-containing protein At3g22... [more]
PP265_ARATH3.857e-2738.22Pentatricopeptide repeat-containing protein At3g46... [more]
PPR32_ARATH3.102e-2637.11Pentatricopeptide repeat-containing protein At1g11... [more]
PP251_ARATH5.569e-2638.22Putative pentatricopeptide repeat-containing prote... [more]
PP371_ARATH1.241e-2540.72Pentatricopeptide repeat-containing protein At5g08... [more]
PP296_ARATH1.620e-2536.14Pentatricopeptide repeat-containing protein At3g63... [more]
PP267_ARATH2.116e-2539.52Pentatricopeptide repeat-containing protein At3g47... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00342 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00342 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623251 ID=BQ623251|Name=BQ623251|organism=Citrus sinensis|type=EST|length=546bp
GACATGTACGCTAAGTGCAAGAGTGTTGATGTGGCACCGTGTTATGTTTG
ATGCAATTGCACCAAAAAACAGGGATGTTGCAACTTGGACAGTAATGATA
GGTAGTTATTCTCAGAATGGAGGAGCCAATGATGCCCTGGCACTTTTTCC
TCAGATGTTCCAGCAAGATAAACTTGTAAAGCCAAATGCTTTTACTTTAT
CTTGTGCTCTTATGGCTTGTGCTCGTTTGGCTGCACTGAGATTTGGTAGA
CAAATTCATGCATATGTGCTGCGGAATCAATATGAGATGTTGATTCCGTT
TGTGGCCAATTGCCTGATAGATATGTATTCACGATCAGGAGACATTGACA
CAGCTAGAGTTGTATTTGATAACTTGAAGCAAAGAAATGTTGTTTCCTGG
ACATCCTTGATGACAGGTTATGGCATGCACGGTCTTGGCGACAAAGCTCA
CTGGGCTTTTGATCAGATGAGGAAAGAAGGTCTAGCACCTGATGGTGTAA
CCTTCCTTGGTCTGCTCTATGCTTGCAGCCACTCAGGAATGGGTGA
back to top