BQ623259

Overview
NameBQ623259
Unique NameBQ623259
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length624
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8587 contig Csv1_Contig8587:678..1301. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623259 vs. ExPASy Swiss-Prot
Match: PPA8_ARATH (Purple acid phosphatase 8 OS=Arabidopsis thaliana GN=PAP8 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 9.273e-85
Identity = 142/199 (71.36%), Postives = 167/199 (83.92%), Query Frame = 1
Query:    1 VEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGSKAWKGDIDWWNPKEDKFYYDGQGFMSVQITPTEVDVAFYDIFGNVIHKWSTSK 597
            V AQLSP+LRD+D RW+CLRS++VNAEI +  FVDTTPFV++YF +P+DHVYDW G+ PR  YL +LL DVD AL+ES AKWKIVVGHHTIKS+GHHGNT EL  QLLPIL+ NEVDLYINGHDHCLE ISS  SGIQF+TSGGGSKAWKGD++ WNP+E +FYYDGQGFMSV  +  E+ V FYD  G+V+H+WST K
Sbjct:  130 VYAQLSPILRDLDCRWICLRSYVVNAEIVDIFFVDTTPFVDRYFDEPKDHVYDWRGVLPRNKYLNSLLTDVDVALQESMAKWKIVVGHHTIKSAGHHGNTIELEKQLLPILEANEVDLYINGHDHCLEHISSINSGIQFMTSGGGSKAWKGDVNDWNPQEMRFYYDGQGFMSVYTSEAELRVVFYDGLGHVLHRWSTLK 328          
BLAST of BQ623259 vs. ExPASy Swiss-Prot
Match: PPA3_ARATH (Purple acid phosphatase 3 OS=Arabidopsis thaliana GN=PAP3 PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.138e-81
Identity = 136/196 (69.39%), Postives = 165/196 (84.18%), Query Frame = 1
Query:    1 VEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGSKAWK-GDIDWWNPKEDKFYYDGQGFMSVQITPTEVDVAFYDIFGNVIHKW 585
            V AQLSP+LR +D+RW+C+RSFIVNAEI +  FVDTTPFV+KYF  P  HVYDWSG+ PR++YL NLLK++D AL+ES AKWKIV+GHHTIKS+GHHGNT EL   LLPILQ NEVDLY+NGHDHCLE ISS +S IQF+TSGGGSKAWK GD+++  P+E +FYYDGQGFMSV ++  E+ V FYD+FG+V+H W
Sbjct:  159 VRAQLSPMLRALDNRWVCMRSFIVNAEIVDLFFVDTTPFVDKYFIQPNKHVYDWSGVLPRQTYLNNLLKELDVALRESVAKWKIVIGHHTIKSAGHHGNTIELEKHLLPILQANEVDLYVNGHDHCLEHISSVDSNIQFMTSGGGSKAWKGGDVNYVEPEEMRFYYDGQGFMSVHVSEAELRVVFYDVFGHVLHHW 354          
BLAST of BQ623259 vs. ExPASy Swiss-Prot
Match: PPA4_ARATH (Purple acid phosphatase 4 OS=Arabidopsis thaliana GN=PAP4 PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 8.981e-80
Identity = 134/203 (66.01%), Postives = 166/203 (81.77%), Query Frame = 1
Query:    1 VEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGSKAWKGDIDWWNPKEDKFYYDGQGFMSVQITPTEVDVAFYDIFGNVIHKWSTSKQLYS 609
            VEAQLSP+LR +DSRW+C+RSFIV+AEIAE  FVDTTPFV+ YF  P+D  YDWSG+ PRKSYL  +L +++  L+ES+AKWKIVVGHH IKS+  HGNT EL   LLPIL+ N+VDLY+NGHDHCL+ IS+++S IQFLTSGGGSKAW+G  +W  P++ KF+YDGQGFMSV+IT +E+ V FYD+ GN +HKW TSK L S
Sbjct:  131 VEAQLSPILRSMDSRWICMRSFIVDAEIAELFFVDTTPFVDAYFLSPQDQTYDWSGVSPRKSYLQTILTELEMGLRESSAKWKIVVGHHAIKSASIHGNTKELESLLLPILEANKVDLYMNGHDHCLQHISTSQSPIQFLTSGGGSKAWRGYYNWTTPEDMKFFYDGQGFMSVKITRSELSVVFYDVSGNSLHKWDTSKMLDS 333          
BLAST of BQ623259 vs. ExPASy Swiss-Prot
Match: PPA17_ARATH (Purple acid phosphatase 17 OS=Arabidopsis thaliana GN=PAP17 PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 2.531e-74
Identity = 126/202 (62.38%), Postives = 161/202 (79.70%), Query Frame = 1
Query:    4 EAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGSKAWKGDID--WWNPKEDKFYYDGQGFMSVQITPTEVDVAFYDIFGNVIHKWSTSKQL 603
            EAQLS VLR+IDSRW+CLRSF+V+AE+ E  FVDTTPFV +Y+T+ + H YDW  +  R SY+  LL+D++ +LK S A+WKIVVGHH ++S GHHG+T ELN +LLPIL+EN VDLY+NGHDHCL+ +S  +S IQFLTSG GSKAW+GDI+    NPK  KFYYDGQGFMS + T ++ ++ FYD+FG ++HKW TSKQL
Sbjct:  132 EAQLSSVLREIDSRWICLRSFVVDAELVEMFFVDTTPFVKEYYTEADGHSYDWRAVPSRNSYVKALLRDLEVSLKSSKARWKIVVGHHAMRSIGHHGDTKELNEELLPILKENGVDLYMNGHDHCLQHMSDEDSPIQFLTSGAGSKAWRGDINPVTINPKLLKFYYDGQGFMSARFTHSDAEIVFYDVFGEILHKWVTSKQL 333          
BLAST of BQ623259 vs. ExPASy Swiss-Prot
Match: PPA7_ARATH (Purple acid phosphatase 7 OS=Arabidopsis thaliana GN=PAP7 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 4.623e-68
Identity = 119/200 (59.50%), Postives = 149/200 (74.50%), Query Frame = 1
Query:    1 VEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGSKAWKGDIDWWNPKEDKFYYDGQGFMSVQITPTEVDVAFYDIFGNVIHKWSTSKQ 600
            VEAQLS VL   D RW C RSF++++ + +F F DT PFV KYFT+PEDH YDW  + PR  Y++NLL D+D  +K+S A WK VVGHH IK++G+HG T EL  QLLPIL+EN+VDLYINGHDHCL+ I S     QFLTSGGGSKAW+G +  W+PKE K YYDGQGFMS+ IT ++    +YD+ GNV+H+ S SK+
Sbjct:  126 VEAQLSKVLTQKDWRWFCRRSFVLSSGMVDFFFADTNPFVEKYFTEPEDHTYDWRNVLPRNKYISNLLHDLDLEIKKSRATWKFVVGHHGIKTAGNHGVTQELVDQLLPILEENKVDLYINGHDHCLQHIGS-HGKTQFLTSGGGSKAWRGHVQPWDPKELKLYYDGQGFMSLHITHSKAKFIYYDVSGNVLHRSSLSKR 324          
The following BLAST results are available for this feature:
BLAST of BQ623259 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
PPA8_ARATH9.273e-8571.36Purple acid phosphatase 8 OS=Arabidopsis thaliana ... [more]
PPA3_ARATH2.138e-8169.39Purple acid phosphatase 3 OS=Arabidopsis thaliana ... [more]
PPA4_ARATH8.981e-8066.01Purple acid phosphatase 4 OS=Arabidopsis thaliana ... [more]
PPA17_ARATH2.531e-7462.38Purple acid phosphatase 17 OS=Arabidopsis thaliana... [more]
PPA7_ARATH4.623e-6859.50Purple acid phosphatase 7 OS=Arabidopsis thaliana ... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00350 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00350 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623259 ID=BQ623259|Name=BQ623259|organism=Citrus sinensis|type=EST|length=624bp
GTTGAGGCACAATTGAGTCCCGTACTTAGAGACATAGACAGCCGATGGCT
TTGCTTGAGGTCTTTCATCGTTAACGCCGAAATTGCGGAATTTATCTTCG
TAGACACGACTCCTTTTGTTAATAAGTACTTCACAGATCCGGAAGACCAT
GTTTATGATTGGAGTGGCATTCAACCCAGAAAATCTTACCTTGCAAATCT
CCTCAAGGATGTTGATTCAGCTTTGAAAGAATCAACAGCAAAATGGAAAA
TAGTAGTAGGTCACCACACAATCAAAAGTAGCGGCCATCATGGTAACACT
CATGAGCTTAACTTGCAACTCCTCCCAATCCTTCAGGAAAACGAAGTTGA
TCTTTACATTAATGGGCATGACCATTGCCTGGAACGCATCAGTAGCACCG
AGAGTGGAATTCAATTTTTGACAAGTGGAGGGGGCTCAAAGGCATGGAAA
GGAGATATTGATTGGTGGAATCCAAAAGAAGATAAATTCTATTACGATGG
ACAAGGTTTTATGTCGGTTCAAATCACCCCAACCGAAGTTGATGTTGCTT
TTTATGATATCTTTGGCAACGTTATCCACAAATGGAGCACTTCCAAACAG
CTTTACTCTGCTCTCTAAGGTAGT
back to top