BQ623340

Overview
NameBQ623340
Unique NameBQ623340
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length656
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig18 contig Csv1_Contig18:1..656. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: Y2579_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.251e-15
Identity = 62/188 (32.98%), Postives = 91/188 (48.40%), Query Frame = 1
Query:   97 PKNTFLMSS--LRRLDLSYNKLTGSLPK-LPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*APIGFFSGDLPVARRLGDN 651
            P + F  SS  LR L+LS N  +GS+P+   PNL  L L NN+ +G I  N     + L V++L  N  TG +  +   L  L+ + L++N LT  G+   +    +L  + LG+N + G +P        L+ L + YN L G IP      K L+ +FL  N L G  P   FS    ++    DN
Sbjct:  114 PHDIFTTSSPSLRYLNLSNNNFSGSIPRGFLPNLYTLDLSNNMFTGEIY-NDIGVFSNLRVLDLGGNVLTGHVPGYLGNLSRLEFLTLASNQLTG-GVPVELGKMKNLKWIYLGYNNLSGEIPYQIGGLSSLNHLDLVYNNLSGPIPPSLGDLKKLEYMFLYQNKLSGQIPPSIFSLQNLISLDFSDN 299          

HSP 2 Score: 74.7146 bits (182), Expect = 4.693e-13
Identity = 64/203 (31.53%), Postives = 95/203 (46.80%), Query Frame = 1
Query:    7 SFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLP----PNLSELALKNNVLSGVITKNSFDGLT-QLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            SF SS+ D L  L                   N   +S +  LDLS   ++G +        P L  + L NN LSG I  + F   +  L  + LS N+F+G++   F  LP L  ++LSNN  T   I   +   S+L  +DLG N + G++P    +   L  L++  N+L GG+P+E    K+LK ++L  N L G  P
Sbjct:   37 SFKSSIQDPLKHLSSWSYSSTNDVCLWSGVVCNN--ISRVVSLDLSGKNMSGQILTAATFRLPFLQTINLSNNNLSGPIPHDIFTTSSPSLRYLNLSNNNFSGSIPRGF--LPNLYTLDLSNNMFTGE-IYNDIGVFSNLRVLDLGGNVLTGHVPGYLGNLSRLEFLTLASNQLTGGVPVELGKMKNLKWIYLGYNNLSGEIP 234          

HSP 3 Score: 71.633 bits (174), Expect = 3.973e-12
Identity = 68/227 (29.96%), Postives = 96/227 (42.29%), Query Frame = 1
Query:    1 SNSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKL---PPNLSELALKNNVLSGVITKNSFDGLTQ-LEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTL--------------TRVGISK-----PVDGRSD-LVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*APIGF 609
            SN+ +  +P+ +T L                 P N    ++L  LDLS N LTG LP       +L++L L +N L   I  +   G+ Q LE + L  N F+G L   F  L  +  ++LSNN L                + ++K     P   RS  L  +DL  NKI G +P     +P +  L +  N + G IP E S  K+L  L L  N   G  P  F
Sbjct:  322 SNNLTGKIPEGVTSLPRLKVLQLWSNRFSGGIPANLGKHNNLTVLDLSTNNLTGKLPDTLCDSGHLTKLILFSNSLDSQIPPSL--GMCQSLERVRLQNNGFSGKLPRGFTKLQLVNFLDLSNNNLQGNINTWDMPQLEMLDLSVNKFFGELPDFSRSKRLKKLDLSRNKISGVVPQGLMTFPEIMDLDLSENEITGVIPRELSSCKNLVNLDLSHNNFTGEIPSSF 546          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: RCH2_ARATH (Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.839e-15
Identity = 62/202 (30.69%), Postives = 94/202 (46.53%), Query Frame = 1
Query:    4 NSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALK---NNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            N  S S+P S+ +L                 P      SSL +L L  N+++G +P     L++L L    +N L G I     D  T L+ ++LS NS TGT+ +  F+L  L ++ L +N+L+   I + +   S LV + LGFN+I G +P        ++ L    NRL G +P E      L+ + L  N L G  P
Sbjct:  332 NLLSGSIPSSIGRLSFLEEFMISDNKFSGSIPTTISNCSSLVQLQLDKNQISGLIPSELGTLTKLTLFFAWSNQLEGSIPPGLAD-CTDLQALDLSRNSLTGTIPSGLFMLRNLTKLLLISNSLSGF-IPQEIGNCSSLVRLRLGFNRITGEIPSGIGSLKKINFLDFSSNRLHGKVPDEIGSCSELQMIDLSNNSLEGSLP 531          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: Y4294_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 8.552e-15
Identity = 64/209 (30.62%), Postives = 98/209 (46.89%), Query Frame = 1
Query:    4 NSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITK--NSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVA-VDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*APIGFFSGD 621
            N FSSS+P  + +                  P++   + SL+ LD+S N L+G LPK    L++L   N   +G   K    F+ ++ LEV++L  NS  G L+  FFLL     V++S N L      K + G S+ +  ++L  N+++G L   F  +  L  L + YN L G +P  F++   L+ L L  N   G  P     GD
Sbjct:  112 NLFSSSLPKEIGRSVSLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSNGFTGKMPRGFELISSLEVLDLHGNSIDGNLDGEFFLLTNASYVDISGNRLVTTS-GKLLPGVSESIKHLNLSHNQLEGSLTSGFQLFQNLKVLDLSYNMLSGELP-GFNYVYDLEVLKLSNNRFSGSLPNNLLKGD 318          

HSP 2 Score: 68.9366 bits (167), Expect = 2.575e-11
Identity = 58/209 (27.75%), Postives = 89/209 (42.58%), Query Frame = 1
Query:    1 SNSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*APIGFFSGDLP 627
            +N FS S+P++L +                  P ++ + ++L  LDLS N LTG LP L      L L NN   G +T+  +     +E ++LS+N FTG+       L     +NLS N LT     +       L  +D+  N ++G +P      P L  + ++ N + G I    S    ++ L L  N          F GDLP
Sbjct:  303 NNRFSGSLPNNLLKGDSLLLTTLDLSGNNLSGPVSSIMSTTLHTLDLSSNSLTGELPLLTGGCVLLDLSNNQFEGNLTR--WSKWENIEYLDLSQNHFTGSFPDATPQLLRANHLNLSYNKLTGSLPERIPTHYPKLRVLDISSNSLEGPIPGALLSMPTLEEIHLQNNGMTGNIGPLPSSGSRIRLLDLSHN---------RFDGDLP 500          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: Y1341_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.459e-14
Identity = 63/200 (31.50%), Postives = 89/200 (44.50%), Query Frame = 1
Query:    4 NSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSELAL---KNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLS-SLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG 591
            NS S  +P S+ + +                PK    + +L  LDL  N  +G LP    N++ L L    NN ++G I       L  LE ++LS NSFTG +   F  L  L ++ L+NN LT   I K +     L  +DL +N + G +P        L+ +L + YN   G IP  FS    L+ L L  N L G
Sbjct:  438 NSLSGGLPKSVAKCQSLVRLRVGENQLSGQIPKEIGELQNLVFLDLYMNHFSGGLPYEISNITVLELLDVHNNYITGDIPAQ-LGNLVNLEQLDLSRNSFTGNIPLSFGNLSYLNKLILNNNLLTG-QIPKSIKNLQKLTLLDLSYNSLSGEIPQELGQVTSLTINLDLSYNTFTGNIPETFSDLTQLQSLDLSSNSLHG 635          

HSP 2 Score: 68.1662 bits (165), Expect = 4.392e-11
Identity = 60/203 (29.56%), Postives = 91/203 (44.83%), Query Frame = 1
Query:    4 NSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLP----KLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            N  + S+P  L +L+                P      SSL   D+S N LTG +P    KL   L +L L +N+ +G I        + L  ++L +N  +G++ +    L +LQ   L  N+++   I       +DLVA+DL  NK+ G +P        LS L +  N L GG+P   +  +SL RL +  N L G  P
Sbjct:  270 NKLTGSIPKELGKLQKITSLLLWGNSLSGVIPPEISNCSSLVVFDVSANDLTGDIPGDLGKLVW-LEQLQLSDNMFTGQIPWE-LSNCSSLIALQLDKNKLSGSIPSQIGNLKSLQSFFLWENSISGT-IPSSFGNCTDLVALDLSRNKLTGRIPEELFSLKRLSKLLLLGNSLSGGLPKSVAKCQSLVRLRVGENQLSGQIP 469          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: DR100_ARATH (DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.459e-14
Identity = 66/182 (36.26%), Postives = 90/182 (49.45%), Query Frame = 1
Query:  115 MSSLRRLDLSYNKLTGSLPKLPPNLSELALKN---NVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*APIGFFSGDLPVARRLGDN 651
            ++SLR LDL+ NK+TG +P     LS+LA+ N   N +SG I   S   L +L+ +EL+EN  TG + A F  L  L +V L  N LT   I + + G   L  +DL  N I+G +P    +  +LS L++  N L G IP        L    L  N L G  P  F S    V+  L  N
Sbjct:  134 LASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPA-SLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTG-SIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHN 313          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: GSO1_ARATH (LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.250e-14
Identity = 62/212 (29.25%), Postives = 101/212 (47.64%), Query Frame = 1
Query:    1 SNSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLS---ELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*APIGFFSGDLP 627
            +NS +  +P  L ++                 PK+   + +L+ LDLS N LTG +P+   N+S   +L L NN LSG + K+     T LE + LS    +G +        +L+Q++LSNN+L    I + +    +L  + L  N ++G L  + ++   L  L + +N L G +P E S  + L+ LFL  N          FSG++P
Sbjct:  248 NNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAG-SIPEALFELVELTDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYEN---------RFSGEIP 449          

HSP 2 Score: 71.633 bits (174), Expect = 3.973e-12
Identity = 61/203 (30.05%), Postives = 88/203 (43.35%), Query Frame = 1
Query:    1 SNSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNL---SELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            SN  +  +P  L  L                 P+    + +L+ L L+  +LTG +P     L     L L++N L G I        + L V   +EN   GT+ A    L  L+ +NL+NN+LT   I   +   S L  + L  N++QG +P + AD   L +L +  N L G IP EF +   L  L L  N L G  P
Sbjct:  128 SNQLTGEIPSQLGSLVNIRSLRIGDNELVGDIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGPIPAE-LGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTG-EIPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLP 328          

HSP 3 Score: 67.3958 bits (163), Expect = 7.492e-11
Identity = 67/226 (29.65%), Postives = 88/226 (38.94%), Query Frame = 1
Query:    4 NSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPN---LSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVD------------------------LGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            N FS  +P  +                    P +   +  L  L L  N+L G LP    N   L+ L L +N LSG I  +SF  L  LE + L  NS  G L      L  L ++NLS+N L   G   P+ G S  ++ D                        LG N++ G +P        LS L M  N L G IPL+    K L  + L+ NFL G  P
Sbjct:  442 NRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIP-SSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLN--GTIHPLCGSSSYLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVLCKKLTHIDLNNNFLSGPIP 664          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: Y4361_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.240e-14
Identity = 62/205 (30.24%), Postives = 92/205 (44.88%), Query Frame = 1
Query:    1 SNSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPNLSEL---ALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTR-VGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*API 603
            SN+FS  +P  L  L                 P +   + SL+ L L +N L G+LP    N S L   +   N + GVI   ++  L +LEV+ LS N+F+GT+    F   +L  V L  N  +  V      + R+ L  +DL  N+I G  P+   +   L +L +  N   G IP +  + K L+ L L  N L G  P+
Sbjct:  171 SNTFSGQIPSGLANLTQLQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFNLLQGTLPSAISNCSSLVHLSASENEIGGVIPA-AYGALPKLEVLSLSNNNFSGTVPFSLFCNTSLTIVQLGFNAFSDIVRPETTANCRTGLQVLDLQENRISGRFPLWLTNILSLKNLDVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIPV 374          

HSP 2 Score: 77.0258 bits (188), Expect = 9.456e-14
Identity = 65/227 (28.63%), Postives = 96/227 (42.29%), Query Frame = 1
Query:    4 NSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLP---KLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAV-------------------------DLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            N FS +VP S++ L                 P +   +  L  LDLS   ++G +P      PN+  +AL+ N  SGV+ +  F  L  L  + LS NSF+G +   F  L  L  ++LS+N ++  G   P  G    + V                         DLG N + G +P   +    L+SLS+ +N L G IP  FS   +L ++ L  N L G  P
Sbjct:  462 NRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNNFSGVVPEG-FSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHIS--GSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTKMDLSVNNLTGEIP 685          

HSP 3 Score: 70.0922 bits (170), Expect = 1.156e-11
Identity = 55/207 (26.57%), Postives = 88/207 (42.51%), Query Frame = 1
Query:    4 NSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKL---PPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*APIGFFS 615
            N FS  +P  +  LK                P       SL  LD   N L G +P+       L  L+L  N  SG +  +S   L QLE + L EN+  G+       L +L +++LS N  +   +   +   S+L  ++L  N   G +P +  +   L++L +    + G +P+E S   +++ + L GN   G  P GF S
Sbjct:  342 NLFSGEIPPDIGNLKRLEELKLANNSLTGEIPVEIKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVP-SSMVNLQQLERLNLGENNLNGSFPVELMALTSLSELDLSGNRFSGA-VPVSISNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNNFSGVVPEGFSS 546          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: BRI1_SOLLC (Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.240e-14
Identity = 64/207 (30.92%), Postives = 96/207 (46.38%), Query Frame = 1
Query:    4 NSFSSSVPDSLTQL-KXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLP-----KLPPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPA--LQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            N F    P+ L  L K                P++    SSL  +D+SYN  +G LP     KL  N+  + L  N   G +  +SF  L +LE +++S N+ TG + +     P   L+ + L NN L +  I   +   S LV++DL FN + G +P +      L  L +  N+L G IP E  + ++L+ L LD N L G  P
Sbjct:  313 NDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISYNNFSGKLPVDTLSKL-SNIKTMVLSFNKFVGGL-PDSFSNLLKLETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNN-LFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIP 516          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: RPK1_IPONI (Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 9.456e-14
Identity = 62/202 (30.69%), Postives = 91/202 (45.05%), Query Frame = 1
Query:    4 NSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPN---LSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            N+F+  +P SL  LK                P     +  L  L+LS+N L G LP    N   LSEL   +N+L+G I  ++   LT+L  + L ENSF+G +    F    L  + L  N L   G   PV     L +++L  NK+ G LP++     ML  L + +N L G + +  S  +SL  + +  N   G  P
Sbjct:  509 NNFTGPIPPSLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGILPSELSNCHKLSELDASHNLLNGSIP-STLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLNLQLGGNLLA--GDIPPVGALQALRSLNLSSNKLNGQLPIDLGKLKMLEELDVSHNNLSGTLRV-LSTIQSLTFINISHNLFSGPVP 706          

HSP 2 Score: 67.3958 bits (163), Expect = 7.492e-11
Identity = 57/201 (28.36%), Postives = 78/201 (38.81%), Query Frame = 1
Query:    4 NSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKL--PPNLSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP 600
            N F+  +P +L   K                P +    S+L RL L  N L G LP      NL    L  N  +G I   S   L  +  I LS N  +G++      L  L+ +NLS+N L  + +   +     L  +D   N + G +P        L+ LS+  N   GGIP        L  L L GN L G  P
Sbjct:  438 NMFTGHIPPNLCSQKKLKRLLLGYNYLEGSVPSDLGGCSTLERLILEENNLRGGLPDFVEKQNLLFFDLSGNNFTGPIPP-SLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGI-LPSELSNCHKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLNLQLGGNLLAGDIP 636          
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Match: IMK2_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.235e-13
Identity = 63/211 (29.86%), Postives = 97/211 (45.97%), Query Frame = 1
Query:    1 SNSFSSSVPDSLTQLKXXXXXXXXXXXXXXXXPKNTFLMSSLRRLDLSYNKLTGSLPKLPPN---LSELALKNNVLSGVITKNSFDGLTQLEVIELSENSFTGTLEAWFFLLPALQQVNLSNNTLTRVGISKPVDGRSDLVAVDLGFNKIQGYLPVNFADYPMLSSLSMRYNRLRGGIPLEFSHKKSLKRLFLDGNFLIG*AP--IGFFSG 618
            +N  S S+P SL                    P +    + L RL+LS+N L+G LP        L+ L L++N LSG I     +G   L+ + L  N F+G +         L++V++S+N L+   I +   G   L ++D  +N I G +P +F++   L SL++  N L+G IP       +L  L L  N + G  P  IG  SG
Sbjct:  151 NNRLSGSIPVSLGNCPLLQNLDLSSNQLTGAIPPSLTESTRLYRLNLSFNSLSGPLPVSVARSYTLTFLDLQHNNLSGSIPDFFVNGSHPLKTLNLDHNRFSGAVPVSLCKHSLLEEVSISHNQLSG-SIPRECGGLPHLQSLDFSYNSINGTIPDSFSNLSSLVSLNLESNHLKGPIPDAIDRLHNLTELNLKRNKINGPIPETIGNISG 360          
The following BLAST results are available for this feature:
BLAST of BQ623340 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
Y2579_ARATH2.251e-1532.98Probably inactive leucine-rich repeat receptor-lik... [more]
RCH2_ARATH3.839e-1530.69Receptor-like protein kinase 2 OS=Arabidopsis thal... [more]
Y4294_ARATH8.552e-1530.62Probable LRR receptor-like serine/threonine-protei... [more]
Y1341_ARATH1.459e-1431.50Probable LRR receptor-like serine/threonine-protei... [more]
DR100_ARATH1.459e-1436.26DNA-damage-repair/toleration protein DRT100 OS=Ara... [more]
GSO1_ARATH3.250e-1429.25LRR receptor-like serine/threonine-protein kinase ... [more]
Y4361_ARATH7.240e-1430.24Probable LRR receptor-like serine/threonine-protei... [more]
BRI1_SOLLC7.240e-1430.92Brassinosteroid LRR receptor kinase OS=Solanum lyc... [more]
RPK1_IPONI9.456e-1430.69Receptor-like protein kinase OS=Ipomoea nil GN=INR... [more]
IMK2_ARATH1.235e-1329.86Probably inactive leucine-rich repeat receptor-lik... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00431 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00431 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623340 ID=BQ623340|Name=BQ623340|organism=Citrus sinensis|type=EST|length=656bp
TCCAACTCGTTCTCCAGCTCAGTCCCCGACTCACTCACCCAGCTCAAAAA
TCTCGATTCTTTAGACCTTTCTTATAATTCTCTATCCGGGTCTCTCCCAA
AAAACACATTTTTGATGTCGAGTTTGAGAAGACTCGATCTGAGTTACAAC
AAGCTCACCGGTTCATTACCAAAGCTGCCGCCAAATCTCTCAGAGCTAGC
TCTGAAGAACAATGTTTTATCTGGGGTTATTACAAAGAACTCCTTTGACG
GATTAACTCAGCTGGAAGTTATCGAACTCAGCGAAAACTCGTTCACCGGG
ACACTTGAAGCGTGGTTCTTCCTGTTGCCAGCACTCCAGCAAGTTAACCT
ATCCAATAACACCTTGACACGCGTCGGGATCTCGAAGCCAGTGGATGGCA
GAAGCGACCTGGTGGCGGTTGATCTGGGGTTCAACAAGATCCAAGGGTAC
TTGCCCGTGAATTTCGCTGATTATCCGATGCTGTCGTCTCTGTCGATGCG
TTACAACCGATTACGCGGCGGTATCCCATTGGAGTTCAGTCACAAGAAGT
CTTTGAAGAGGCTGTTTCTGGATGGGAACTTCTTGATTGGGTAAGCACCG
ATAGGATTTTTCAGTGGTGACCTGCCGGTCGCCCGGAGACTGGGGGATAA
TTGTCT
back to top