BQ623342

Overview
NameBQ623342
Unique NameBQ623342
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length663
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Match: LCYE_ARATH (Lycopene epsilon cyclase, chloroplastic OS=Arabidopsis thaliana GN=LUT2 PE=1 SV=2)

HSP 1 Score: 318.931 bits (816), Expect = 1.436e-86
Identity = 157/220 (71.36%), Postives = 182/220 (82.73%), Query Frame = 3
Query:    3 SQLVFVQMQQNKSMDKQSKLADKLPPISIGNGILDLVVIGCGPAGLALAAESAKLGLNVGLIGPDLPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSXXXXXXXXXXXCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEGGGSQSFCPNSLWCWRVKGENNPYDPSLMGFMDYRDCTKQ 662
            S+++FVQMQQNK MD+QSKL DKLPPISIG+G LDLVVIGCGPAGLALAAESAKLGL VGLIGPDLPFTNNYGVWEDEF DLGL+ CIEHVWR+T+VY+D+D+PI IGRAYGRVS           CVESGVSYLSSKV+SITE++ G RLVAC+ + ++PCRLATVASGAASGKLL+YE GG +  C  + +   V+ EN+PYDP  M FMDYRD T +
Sbjct:   76 SEILFVQMQQNKDMDEQSKLVDKLPPISIGDGALDLVVIGCGPAGLALAAESAKLGLKVGLIGPDLPFTNNYGVWEDEFNDLGLQKCIEHVWRETIVYLDDDKPITIGRAYGRVSRRLLHEELLRRCVESGVSYLSSKVDSITEASDGLRLVACDDNNVIPCRLATVASGAASGKLLQYEVGGPR-VCVQTAYGVEVEVENSPYDPDQMVFMDYRDYTNE 294          
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Match: LCYE_SOLLC (Lycopene epsilon cyclase, chloroplastic OS=Solanum lycopersicum GN=CRTL-E-1 PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.373e-81
Identity = 149/216 (68.98%), Postives = 173/216 (80.09%), Query Frame = 3
Query:    3 SQLVFVQMQQNKSMDKQSKLADKLPPISIGNGILDLVVIGCGPAGLALAAESAKLGLNVGLIGPDLPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSXXXXXXXXXXXCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEGGGSQSFCPNSLWCWRVKGENNPYDPSLMGFMDYRD 650
            SQLVFVQMQQ K MD+QSKL+D+L  IS G  +LDLVVIGCGPAGLALAAESAKLGLNVGL+GPDLPFTNNYGVWEDEF+DLGL+ CIEHVWRDT+VY+D+DEPILIGRAYGRVS           CVE+GV YL+SKV+ I E+T+G  LV CE D+++PCR  TVASGAASGK L+YE  GS      + +   V+ +NNP+DPSLM FMDYRD
Sbjct:   73 SQLVFVQMQQKKDMDQQSKLSDELRQISAGQTVLDLVVIGCGPAGLALAAESAKLGLNVGLVGPDLPFTNNYGVWEDEFKDLGLQACIEHVWRDTIVYLDDDEPILIGRAYGRVSRHFLHEELLKRCVEAGVLYLNSKVDRIVEATNGQSLVECEGDVVIPCRFVTVASGAASGKFLQYE-LGSPRVSVQTAYGVEVEVDNNPFDPSLMVFMDYRD 287          
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Match: NXS_SOLTU (Neoxanthin synthase, chloroplastic OS=Solanum tuberosum GN=NXS PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.028e-23
Identity = 72/218 (33.03%), Postives = 107/218 (49.08%), Query Frame = 3
Query:    3 SQLVFVQMQQNKSMDKQSKLADKLPPISIGNGILDLVVIGCGPAGLALAAESAKLGLNVGLIGPD--LPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSXXXXXXXXXXXCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEGGGSQSFCPNSLWCWRVKGENNPYDPSLMGFMDYRD 650
            S L    + + +S D    L D     + G    D+++IG GPAGL LA   +K G+ V  + P     + NNYGVW DEF +LGLE C++H W  T V+I++ +   +GR YGRVS           CVE+ V +  +KV  + E       + C+    +   L   ASG AS   +EY+   +  +         V+ +N+P+D   M  MD+RD
Sbjct:   53 SFLDLAPISKPESFDVNISLVDP----NSGRAQFDVIIIGAGPAGLRLAEHVSKYGIKVCCVDPSPLSMWPNNYGVWVDEFENLGLEDCLDHKWPMTCVHINDHKTKYLGRPYGRVSRKKLKLRLLNSCVENRVKFYKAKVWKV-EHEEFESSIVCDDGKKIRGSLVVDASGFAS-DFIEYDKPRNHGY--QIAHGVLVEVDNHPFDLDKMVLMDWRD 262          
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Match: LCYB_SOLLC (Lycopene beta cyclase, chloroplastic OS=Solanum lycopersicum GN=LCY1 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.369e-20
Identity = 66/206 (32.04%), Postives = 107/206 (51.94%), Query Frame = 3
Query:   48 KQSKLADKLPPISIGNGIL-DLVVIGCGPAGLALAAESAKLGLNVGLIGPD--LPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSXXXXXXXXXXXCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEGGGSQSFCPNSLWCWRV--KGENNPYDPSLMGFMDYRD 650
            K+  L  +LP      G++ DL V+G GPAGLA+A + ++ GL+V  I P+  L + NNYGVW DEF  + L  C++  W    VYID++    + R YGRV+           C+ +GV +  +KV  +    S   L+ C   + +   +   A+G  S  L++Y+    + + P     + +  + E +P+D + M FMD+RD
Sbjct:   65 KKENLDFELPMYDPSKGVVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPNPKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAAVYIDDNTAKDLHRPYGRVNRKQLKSKMMQKCIMNGVKFHQAKVIKVIHEESKSMLI-CNDGITIQATVVLDATG-FSRSLVQYD----KPYNPGYQVAYGILAEVEEHPFDVNKMVFMDWRD 264          
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Match: LCYB_TOBAC (Lycopene beta cyclase, chloroplastic OS=Nicotiana tabacum GN=LCY1 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.788e-20
Identity = 67/206 (32.52%), Postives = 107/206 (51.94%), Query Frame = 3
Query:   48 KQSKLADKLPPISIGNG-ILDLVVIGCGPAGLALAAESAKLGLNVGLIGPD--LPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSXXXXXXXXXXXCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEGGGSQSFCPNSLWCWRV--KGENNPYDPSLMGFMDYRD 650
            K+  L  +LP      G ++DL V+G GPAGLA+A + ++ GL+V  I P   L + NNYGVW DEF  + L  C++  W  TVVYID++    + R YGRV+           C+ +GV +  +KV  +    +   L+ C   + +   +   A+G  S  L++Y+    + + P     + +  + E +P+D S M  MD+RD
Sbjct:   65 KKENLDFELPMYDPSKGLVVDLAVVGGGPAGLAVAQQVSEAGLSVVSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDATWSGTVVYIDDNTTKDLDRPYGRVNRKQLKSKMMQKCILNGVKFHHAKVIKVIHEEAKSMLI-CNDGVTIQATVVLDATG-FSRCLVQYD----KPYKPGYQVAYGILAEVEEHPFDTSKMVLMDWRD 264          
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Match: LCYB_CAPAN (Lycopene beta cyclase, chloroplastic/chromoplastic OS=Capsicum annuum GN=LCY1 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.788e-20
Identity = 66/206 (32.04%), Postives = 106/206 (51.46%), Query Frame = 3
Query:   48 KQSKLADKLPPISIGNGIL-DLVVIGCGPAGLALAAESAKLGLNVGLIGPD--LPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSXXXXXXXXXXXCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEGGGSQSFCPNSLWCWRV--KGENNPYDPSLMGFMDYRD 650
            K+  L  +LP      G++ DL V+G GPAGLA+A + ++ GL+V  I P+  L + NNYGVW DEF  + L  C++  W    VYID+     + R YGRV+           C+ +GV +  +KV  +    S   L+ C   + +   +   A+G  S  L++Y+    + + P     + +  + E +P+D + M FMD+RD
Sbjct:   63 KKENLDFELPMYDPSKGVVVDLAVVGGGPAGLAVAQQVSEAGLSVCSIDPNPKLIWPNNYGVWVDEFEAMDLLDCLDATWSGAAVYIDDKTTKDLNRPYGRVNRKQLKSKMMQKCILNGVKFHQAKVIKVIHEESKSMLI-CNDGITIQATVVLDATG-FSRSLVQYD----KPYNPGYQVAYGILAEVEEHPFDVNKMVFMDWRD 262          
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Match: CCS_CAPAN (Capsanthin/capsorubin synthase, chromoplast OS=Capsicum annuum GN=CCS PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.336e-20
Identity = 62/184 (33.70%), Postives = 93/184 (50.54%), Query Frame = 3
Query:  105 DLVVIGCGPAGLALAAESAKLGLNVGLIGPD--LPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSXXXXXXXXXXXCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEGGGSQSFCPNSLWCWRVKGENNPYDPSLMGFMDYRD 650
            D+++IG GPAGL LA + +K G+ V  + P     + NNYGVW DEF  LGLE C++H W  + V+I + +   + R YGRVS           CVE+ V +  +KV  +        +V C+    +   L   ASG AS   +EY+   +  +          + +N+P+D   M  MD+RD
Sbjct:   83 DVIIIGTGPAGLRLAEQVSKYGIKVCCVDPSPLSMWPNNYGVWVDEFEKLGLEDCLDHKWPVSCVHISDHKTKYLDRPYGRVSRKKLKLKLLNSCVENRVKFYKAKVLKVKHEEFESSIV-CDDGRKISGSLIVDASGYAS-DFIEYDKPRNHGY--QVAHGILAEVDNHPFDLDKMMLMDWRD 262          
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Match: LCYB_ARATH (Lycopene beta cyclase, chloroplastic OS=Arabidopsis thaliana GN=LCY1 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.051e-20
Identity = 61/188 (32.45%), Postives = 97/188 (51.60%), Query Frame = 3
Query:   99 ILDLVVIGCGPAGLALAAESAKLGLNVGLIGPD--LPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSXXXXXXXXXXXCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEGGGSQSFCPNSLWCWRVKGE--NNPYDPSLMGFMDYRD 650
            ++DL ++G GPAGLA+A + ++ GL+V  I P   L + NNYGVW DEF  + L  C++  W   VVY+DE     + R YGRV+           C+ +GV +  SKV ++      +  V C   + +   +   A+G  S  L++Y+    + + P     + +  E   +P+D   M FMD+RD
Sbjct:   82 VVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVVHE-EANSTVVCSDGVKIQASVVLDATG-FSRCLVQYD----KPYNPGYQVAYGIVAEVDGHPFDVDKMVFMDWRD 263          
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Match: CCS_CITSI (Capsanthin/capsorubin synthase, chromoplast OS=Citrus sinensis GN=CCS PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.729e-18
Identity = 61/185 (32.97%), Postives = 93/185 (50.27%), Query Frame = 3
Query:  105 DLVVIGCGPAGLALAAE-SAKLGLNVGLIGPDLPFT--NNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSXXXXXXXXXXXCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEGGGSQSFCPNSLWCWRVKGENNPYDPSLMGFMDYRD 650
            D+++IG GPAGL LA + S++  + V  + P    T  NNYGVW DEF D+GL  C++  W  T V+I++ +   + R YGRVS           CV +GV +  +KV  +        +V C+    +   L   ASG AS   +EY+   +  +          + E++P+D   M  MD+RD
Sbjct:   87 DVIIIGTGPAGLRLAEQVSSRHSVKVCCVDPSPLSTWPNNYGVWVDEFEDIGLVDCLDKTWPMTCVFINDHKTKYLDRPYGRVSRNILKTKLLENCVSNGVKFHKAKVWHVNHQEFESSIV-CDDGNEIKASLIVDASGFAS-SFVEYDKPRNHGY--QIAHGILAEVESHPFDLDKMVLMDWRD 267          
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Match: LCYB_NARPS (Lycopene beta cyclase, chloroplastic/chromoplastic OS=Narcissus pseudonarcissus GN=LCY1 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 8.597e-15
Identity = 57/187 (30.48%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  102 LDLVVIGCGPAGLALAAESAKLGLNVGLIGPD--LPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSXXXXXXXXXXXCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEGGGSQSFCPNSLWCWRV--KGENNPYDPSLMGFMDYRD 650
            LDL V+G GP   + +  S   GL+V  I P+  L + NNYGVW DEF D+ L  C++  W   +VY+D+     + R Y RV+           CV +GV +  + V           L+ C   + +  R+   A+G  S  L++Y+    + + P     + +  + E +P+D   M FMD+RD
Sbjct:   88 LDLAVVGGGPLARSCST-SLGGGLSVVSIDPNPKLIWPNNYGVWVDEFEDMDLLDCLDATWSGAIVYVDDRSTKNLSRPYARVNRKNLKSKMMKKCVSNGVRFHQATVVKAMHEEEKSYLI-CSDGVTIDARVVLDATG-FSRCLVQYD----KPYNPGYQVAYGILAEVEEHPFDVDKMVFMDWRD 267          
The following BLAST results are available for this feature:
BLAST of BQ623342 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
LCYE_ARATH1.436e-8671.36Lycopene epsilon cyclase, chloroplastic OS=Arabido... [more]
LCYE_SOLLC2.373e-8168.98Lycopene epsilon cyclase, chloroplastic OS=Solanum... [more]
NXS_SOLTU5.028e-2333.03Neoxanthin synthase, chloroplastic OS=Solanum tube... [more]
LCYB_SOLLC1.369e-2032.04Lycopene beta cyclase, chloroplastic OS=Solanum ly... [more]
LCYB_TOBAC1.788e-2032.52Lycopene beta cyclase, chloroplastic OS=Nicotiana ... [more]
LCYB_CAPAN1.788e-2032.04Lycopene beta cyclase, chloroplastic/chromoplastic... [more]
CCS_CAPAN2.336e-2033.70Capsanthin/capsorubin synthase, chromoplast OS=Cap... [more]
LCYB_ARATH3.051e-2032.45Lycopene beta cyclase, chloroplastic OS=Arabidopsi... [more]
CCS_CITSI3.729e-1832.97Capsanthin/capsorubin synthase, chromoplast OS=Cit... [more]
LCYB_NARPS8.597e-1530.48Lycopene beta cyclase, chloroplastic/chromoplastic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00433 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00433 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623342 ID=BQ623342|Name=BQ623342|organism=Citrus sinensis|type=EST|length=663bp
GCTCTCAGCTTGTTTTCGTACAAATGCAGCAAAACAAGTCAATGGATAAA
CAGTCTAAATTAGCCGATAAGCTACCGCCAATATCAATTGGTAATGGTAT
TTTGGATTTGGTGGTGATTGGTTGTGGCCCAGCTGGTCTTGCTTTGGCTG
CAGAATCAGCGAAGTTGGGATTAAATGTTGGACTTATTGGCCCGGATCTC
CCTTTCACAAACAATTATGGTGTGTGGGAAGATGAATTTAGAGATCTTGG
ACTTGAAGGGTGTATCGAACATGTCTGGAGAGACACAGTTGTATATATTG
ATGAAGATGAACCCATCTTGATTGGTCGTGCTTATGGACGAGTTAGTCGA
CATTTGCTTCATGAAGAATTATTAAGAAGGTGTGTCGAGTCAGGTGTTTC
ATATCTTAGCTCAAAAGTGGAAAGCATTACGGAATCTACCAGTGGTCATC
GTCTTGTAGCTTGTGAACATGATATGATTGTCCCCTGCAGGCTTGCTACT
GTTGCTTCTGGAGCAGCATCAGGGAAGCTATTGGAATATGAGGGGGGGGG
GTCCCAAAGTTTCTGTCCAAACAGCTTATGGTGTTGGAGGGTTAAGGGGG
AAAATAATCCATATGATCCAAGCCTTATGGGTTTCATGGACTACAGAGAC
TGTACTAAGCAAA
back to top