BQ623343

Overview
NameBQ623343
Unique NameBQ623343
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length303
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:697..999. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.721e-31
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 2
Query:    2 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193
            DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  204 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 267          
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Match: CB23_NICPL (Chlorophyll a-b binding protein C, chloroplastic OS=Nicotiana plumbaginifolia GN=CABC PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.721e-31
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 2
Query:    2 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193
            DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  204 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 267          
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.721e-31
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 2
Query:    2 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193
            DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  202 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265          
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Match: CB22_ORYSJ (Chlorophyll a-b binding protein 2, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB2R PE=2 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 1.721e-31
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 2
Query:    2 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193
            DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  198 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 261          
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Match: CB21_ORYSJ (Chlorophyll a-b binding protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB1R PE=2 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 1.721e-31
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 2
Query:    2 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193
            DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  202 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265          
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.936e-31
Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 2
Query:    2 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193
            DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  211 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK 274          
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Match: CB22_CUCSA (Chlorophyll a-b binding protein of LHCII type 1 (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.936e-31
Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 2
Query:    2 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193
            DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  143 DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 206          
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.936e-31
Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 2
Query:    2 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193
            DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:  192 DPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 255          
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Match: CB2D_SOLLC (Chlorophyll a-b binding protein 1D (Fragment) OS=Solanum lycopersicum GN=CAB1D PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 3.834e-31
Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 2
Query:    2 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193
            DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct:   53 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 116          
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 3.834e-31
Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 2
Query:    2 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193
            DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct:  204 DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 267          
The following BLAST results are available for this feature:
BLAST of BQ623343 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 70
Match NameE-valueIdentityDescription
CB24_TOBAC1.721e-31100.00Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB23_NICPL1.721e-31100.00Chlorophyll a-b binding protein C, chloroplastic O... [more]
CB22_TOBAC1.721e-31100.00Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB22_ORYSJ1.721e-31100.00Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB21_ORYSJ1.721e-31100.00Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB2B_PINSY2.936e-3198.44Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB22_CUCSA2.936e-3198.44Chlorophyll a-b binding protein of LHCII type 1 (F... [more]
CB21_CUCSA2.936e-3198.44Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2D_SOLLC3.834e-3198.44Chlorophyll a-b binding protein 1D (Fragment) OS=S... [more]
CB25_PETSP3.834e-3198.44Chlorophyll a-b binding protein 91R, chloroplastic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00434 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00434 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623343 ID=BQ623343|Name=BQ623343|organism=Citrus sinensis|type=EST|length=303bp
TGACCCGGAGGCTTTTGCTGAGCTCAAGGTTAAGGAAATCAAGAATGGAA
GGTTGGCTATGTTCTCCATGTTTGGTTTCTTCGTTCAGGCCATTGTCACC
GGCAAGGGACCGTTAGAGAACTTGGCCGACCACTTGGCTGACCCTGTCAA
TAACAATGCCTGGGCCTACGCCACCAACTTTGTCCCCGGAAAGTGAGCTT
CGGTTGATAAGAGTTTTTCTCTTTTCGGTTTCTTGGATATCATGTAAATC
TGTTGTGAGCTCATGGAAGCTTTAATTTGAGTTGTGATTATTTATAAAAT
GCT
back to top