BQ623348

Overview
NameBQ623348
Unique NameBQ623348
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length609
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12595 contig Csv1_Contig12595:544..1152. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Match: E131_ARATH (Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis thaliana GN=At1g11820 PE=1 SV=2)

HSP 1 Score: 229.95 bits (585), Expect = 7.524e-60
Identity = 111/148 (75.00%), Postives = 126/148 (85.14%), Query Frame = 3
Query:    3 VSGSGTFLANDTTNQTYCIAMDGVDTKTLQAALDWACGPGRANCSDIQPGEPCYQPNNVKSHASYAFDSYYHEQGKTSGSCDFKGVAMITTTDPSHGSCIFPGSKKVSNKTKAVVNSTQISGAADRLRFISLRGNQISAN-AVAFSIL 443
            VSGSGTFLANDTTNQTYCIAMDGVD KTLQAALDWACGPGR+NCS+IQPGE CYQPNNVK HAS+AF+SYY ++G+ SGSCDFKGVAMITTTDPSHGSCIFPGSKKV N+T+ VVNST+++      R +S RG  ++    V FSIL
Sbjct:  256 VSGSGTFLANDTTNQTYCIAMDGVDAKTLQAALDWACGPGRSNCSEIQPGESCYQPNNVKGHASFAFNSYYQKEGRASGSCDFKGVAMITTTDPSHGSCIFPGSKKVGNRTQTVVNSTEVAAGEATSRSLS-RGFCVTIMILVTFSIL 402          
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Match: E133_ARATH (Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis thaliana GN=At2g01630 PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 1.130e-39
Identity = 71/111 (63.96%), Postives = 92/111 (82.88%), Query Frame = 3
Query:    3 VSGSGTFLANDTTNQTYCIAMDGVDTKTLQAALDWACGPGRANCSDIQPGEPCYQPNNVKSHASYAFDSYYHEQGKTSGSCDFKGVAMITTTDPSHGSCIFPGSKKVSNKT 335
            ++G+G  LANDTTNQT+CIA + VD K LQAALDWACGPG+ +CS +  GE CY+P++V +H++YAF++YY + GK SGSCDFKGVA +TTTDPS G+C+FPGS K SN+T
Sbjct:  344 LAGAGAILANDTTNQTFCIAKEKVDRKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSAK-SNQT 453          
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Match: E132_ARATH (Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis thaliana GN=At1g66250 PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 1.130e-39
Identity = 76/135 (56.30%), Postives = 95/135 (70.37%), Query Frame = 3
Query:    3 VSGSGTFLANDTTNQTYCIAMDGVDTKTLQAALDWACGPGRANCSDIQPGEPCYQPNNVKSHASYAFDSYYHEQGKTSGSCDFKGVAMITTTDPSHGSCIFPGSK------KVSNKTKAVVNSTQISGAADRLRF 389
            ++ SG+ LANDTTNQTYC A +G DTK LQAALDWACGPG+ +CS I+ GE CY+P+NV +HA+YAFD+YYH+ G    +C+F GVA ITTTDPSHG+C+F GS+         N T    NST  SG    L +
Sbjct:  352 LTNSGSVLANDTTNQTYCTAREGADTKMLQAALDWACGPGKIDCSPIKQGETCYEPDNVVAHANYAFDTYYHQTGNNPDACNFNGVASITTTDPSHGTCVFAGSRGNGRNGTSVNITAPSANSTTSSGIRSDLYY 486          
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Match: E134_ARATH (Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis thaliana GN=At3g13560 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.751e-24
Identity = 47/88 (53.41%), Postives = 61/88 (69.32%), Query Frame = 3
Query:   51 YCIAMDGVDTKTLQAALDWACGPGRANCSDIQPGEPCYQPNNVKSHASYAFDSYYHEQGKTSGSCDFKGVAMITTTDPSHGSCIFPGS 314
            +C+A    D   L   L+WACG GRANC+ IQPG+PCY PN+VKSHAS+AF+ YY +     G+CDF G A+ TT DPS+ +C + GS
Sbjct:  362 FCVAKADADDDKLVDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTRDPSYRTCAYTGS 449          
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Match: E1312_ARATH (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana GN=At4g29360 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 3.651e-22
Identity = 52/134 (38.81%), Postives = 74/134 (55.22%), Query Frame = 3
Query:   51 YCIAMDGVDTKTLQAALDWACGPGRANCSDIQPGEPCYQPNNVKSHASYAFDSYYHEQGKTSGSCDFKGVAMITTTDPSHGSCIFPGSKKVS--NKTKAVVNSTQISGAADRLRFISLRGNQISANAVAFSILL 446
            +CIA        LQ ALDWACGPG  +CS +QP +PC++P+ V SHASYAF++YY + G +S  C F G ++    DPS+G+C++  +      N+T A   +  I+     L   S          VA S+LL
Sbjct:  391 WCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLYMIAPATDGFNRTMAGNITGNITAIDSPLASPSSTNEAFRQMVVAVSVLL 524          
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Match: E1313_ARATH (Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis thaliana GN=At5g56590 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.036e-21
Identity = 48/125 (38.40%), Postives = 76/125 (60.80%), Query Frame = 3
Query:   39 TNQTYCIAMDGVDTKTLQAALDWACGPGRANCSDIQPGEPCYQPNNVKSHASYAFDSYYHEQGKTSGSCDFKGVAMITTTDPSHGSCIFPGSKKVSNKTKAVVNSTQISGAADRLRFISLRGNQI 413
            ++ ++CIA      + L+ ALDWACGPG  +C+ IQP +PC+QP+ + SHAS+ F+SY+ +   T  +C F G  +    DPS+  CI+  +    NKTKA  N+T ++ +A      + RGN++
Sbjct:  365 SSNSWCIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNRATDVACSFGGAGVKVNKDPSYDKCIYITAG--GNKTKA-TNATALTSSAS-----TPRGNEL 481          
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 7.612e-20
Identity = 42/102 (41.18%), Postives = 62/102 (60.78%), Query Frame = 3
Query:    6 SGSGTFLANDTTNQTYCIAMDGVDTKTLQAALDWACGPGRANCSDIQPGEPCYQPNNVKSHASYAFDSYYHEQGKTSGSCDFKGVAMITTTDPSHGSCIFPG 311
            S S    +   T+  +C+   G   + LQA+LDWACG G  +C  IQPG  C++PNNV SHA+YA + Y+ +  K    CDF   A +T+ +PS+ +C++PG
Sbjct:  349 SSSSQTPSGKVTSSGWCVPKKGATNEELQASLDWACGHG-IDCGAIQPGGACFEPNNVVSHAAYAMNMYFQKSPKQPTDCDFSKTATVTSQNPSYNNCVYPG 449          
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Match: E13L3_ARATH (Glucan endo-1,3-beta-glucosidase-like protein 3 OS=Arabidopsis thaliana GN=At5g08000 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.893e-19
Identity = 42/104 (40.38%), Postives = 65/104 (62.50%), Query Frame = 3
Query:   18 TFLANDTTNQTYCIAMDGVDTKTLQAALDWACGPGRANCSDIQPGEPCYQPNNVKSHASYAFDSYYHEQGKTSGSCDFKGVAMITTTDPSHGSCIFPGSKKVSN 329
            T L    T+ ++C+   G+    LQ  LD+ACG G A+C+   P   C+ P+NV++H +YA +S++ ++G+ S SC+F G A +TTTDPS+  C FP S   S+
Sbjct:   10 TLLMAGHTSASWCVCKTGLSDSVLQKTLDYACGNG-ADCNPTHPKGSCFNPDNVRAHCNYAVNSFFQKKGQASESCNFTGTATLTTTDPSYTGCAFPSSASGSS 112          
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Match: E13L2_ARATH (Glucan endo-1,3-beta-glucosidase-like protein 2 OS=Arabidopsis thaliana GN=At5g61130 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.934e-19
Identity = 41/106 (38.68%), Postives = 68/106 (64.15%), Query Frame = 3
Query:   39 TNQTYCIAMDGVDTKTLQAALDWACGPGRANCSDIQPGEPCYQPNNVKSHASYAFDSYYHEQGKTSGSCDFKGVAMITTTDPSHGSCIFPGSKKVSNKTKAVVNST 356
            ++ ++C+   G+    LQA LD+ACG G A+C+  +P + C+ P+NV+SH +YA +S++ ++G++ GSC+F G A  T +DPS+  C FP S   S+ +  V   T
Sbjct:   17 SSASWCVCKTGLSDTVLQATLDYACGNG-ADCNPTKPKQSCFNPDNVRSHCNYAVNSFFQKKGQSPGSCNFDGTATPTNSDPSYTGCAFPTSASGSSGSTTVTPGT 121          
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Match: E13L1_ARATH (Glucan endo-1,3-beta-glucosidase-like protein 1 OS=Arabidopsis thaliana GN=At3g58100 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 1.099e-18
Identity = 41/114 (35.96%), Postives = 70/114 (61.40%), Query Frame = 3
Query:   45 QTYCIAMDGVDTKTLQAALDWACGPGRANCSDIQPGEPCYQPNNVKSHASYAFDSYYHEQGKTSGSCDFKGVAMITTTDPSHGSCIFPGSKKVSNKTKAVVNSTQISGAADRLR 386
            + +C+A +  +  +LQ A++WACG G A+C  IQ G PC  P +V+  AS+ F++YY + G+   +C+F   A +T+ +PS G+C +P SK  +N  +   +++  +G AD  R
Sbjct:   39 ELWCVAKNNAEDSSLQTAIEWACGQGGADCGPIQQGGPCNDPTDVQKMASFVFNNYYLKNGEEDEACNFNNNAALTSLNPSQGTCKYPSSKG-ANNGRLADDTSMGAGQADMSR 151          
The following BLAST results are available for this feature:
BLAST of BQ623348 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
E131_ARATH7.524e-6075.00Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis ... [more]
E133_ARATH1.130e-3963.96Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis ... [more]
E132_ARATH1.130e-3956.30Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis ... [more]
E134_ARATH1.751e-2453.41Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis ... [more]
E1312_ARATH3.651e-2238.81Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis... [more]
E1313_ARATH4.036e-2138.40Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis... [more]
E137_ARATH7.612e-2041.18Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis ... [more]
E13L3_ARATH2.893e-1940.38Glucan endo-1,3-beta-glucosidase-like protein 3 OS... [more]
E13L2_ARATH4.934e-1938.68Glucan endo-1,3-beta-glucosidase-like protein 2 OS... [more]
E13L1_ARATH1.099e-1835.96Glucan endo-1,3-beta-glucosidase-like protein 1 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00439 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00439 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623348 ID=BQ623348|Name=BQ623348|organism=Citrus sinensis|type=EST|length=609bp
ATGTGTCGGGAAGTGGGACATTTTTGGCCAACGATACAACAAACCAGACA
TATTGTATTGCAATGGATGGTGTTGATACAAAGACATTGCAGGCAGCACT
GGATTGGGCGTGTGGCCCTGGGAGAGCTAATTGTAGTGATATTCAACCTG
GGGAACCTTGTTATCAGCCTAATAATGTGAAGAGCCACGCTTCTTATGCC
TTTGATAGCTATTACCATGAGCAAGGGAAGACTTCCGGGTCTTGTGATTT
CAAGGGCGTGGCGATGATCACCACAACGGACCCAAGTCATGGGAGCTGTA
TATTTCCTGGCAGTAAGAAGGTAAGCAATAAGACGAAAGCAGTTGTAAAC
TCAACTCAAATAAGTGGAGCAGCAGATAGGCTGAGATTCATCTCCCTCCG
CGGCAACCAAATAAGCGCAAATGCTGTAGCTTTTTCTATTTTGTTATTCA
TTCCCTTTATGACTCCGTGGTGGGGTGTCCAGTCATCTTTTTCCTTTTTT
TTTCCCCCACATGTATCATTGTTTTGCTTTTGAATTTGTTGGTAATCAAG
AGCTGCTGCAGGGAGTTGTTGTTTAGTGGGTAGATTCAGTAGAAGTGCAT
GTGATAATT
back to top