BQ623351

Overview
NameBQ623351
Unique NameBQ623351
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length706
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10453 contig Csv1_Contig10453:309..1015. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Match: ERF99_ARATH (Ethylene-responsive transcription factor 13 OS=Arabidopsis thaliana GN=ERF13 PE=2 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 2.403e-29
Identity = 57/77 (74.03%), Postives = 68/77 (88.31%), Query Frame = 1
Query:  391 KVVHYRGVRTRPWGKYAAEIRDPKKNGARVWLGTYDTPEGAALAYDKAAFEMRGSKAKLNFPHLLGRGNFKPGRVTP 621
            K + YRGVR RPWGK+AAEIRDPKKNGARVWLGTY+TPE AA+AYD+AAF++RGSKAKLNFPHL+G   ++P R+ P
Sbjct:   88 KGMQYRGVRRRPWGKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPVRIRP 164          
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Match: ERF1_TOBAC (Ethylene-responsive transcription factor 1 OS=Nicotiana tabacum GN=ERF1 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.116e-26
Identity = 59/89 (66.29%), Postives = 66/89 (74.16%), Query Frame = 1
Query:  400 HYRGVRTRPWGKYAAEIRDPKKNGARVWLGTYDTPEGAALAYDKAAFEMRGSKAKLNFPHLLGRGNFKPGRVT-----PPTPLSVAHQS 651
            HYRGVR RPWGK+AAEIRDP KNGARVWLGTY+T E AA+AYDKAA+ MRGSKA LNFPH +G    +P RVT      P P S +  S
Sbjct:  104 HYRGVRRRPWGKFAAEIRDPAKNGARVWLGTYETDEEAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPVRVTAKRRASPEPASSSENS 192          
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Match: ERF2_TOBAC (Ethylene-responsive transcription factor 2 OS=Nicotiana tabacum GN=ERF2 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.248e-26
Identity = 55/73 (75.34%), Postives = 61/73 (83.56%), Query Frame = 1
Query:  400 HYRGVRTRPWGKYAAEIRDPKKNGARVWLGTYDTPEGAALAYDKAAFEMRGSKAKLNFPHLLGRGNFKPGRVT 618
            HYRGVR RPWGK+AAEIRDP KNGARVWLGTY+T E AALAYDKAA+ MRGSKA LNFPH +G    +P R+T
Sbjct:   98 HYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDKAAYRMRGSKALLNFPHRIGLNEPEPVRLT 170          
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Match: ERF2_NICSY (Ethylene-responsive transcription factor 2 OS=Nicotiana sylvestris GN=ERF2 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.248e-26
Identity = 55/73 (75.34%), Postives = 61/73 (83.56%), Query Frame = 1
Query:  400 HYRGVRTRPWGKYAAEIRDPKKNGARVWLGTYDTPEGAALAYDKAAFEMRGSKAKLNFPHLLGRGNFKPGRVT 618
            HYRGVR RPWGK+AAEIRDP KNGARVWLGTY+T E AALAYDKAA+ MRGSKA LNFPH +G    +P R+T
Sbjct:  102 HYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDKAAYRMRGSKALLNFPHRIGLNEPEPVRLT 174          
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Match: ERF1_SOLLC (Ethylene-responsive transcription factor 1 OS=Solanum lycopersicum GN=ERF1 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.540e-26
Identity = 59/89 (66.29%), Postives = 66/89 (74.16%), Query Frame = 1
Query:  385 QAKVVHYRGVRTRPWGKYAAEIRDPKKNGARVWLGTYDTPEGAALAYDKAAFEMRGSKAKLNFPHLLGRGNFKPGRVTPPTPLSVAHQS 651
            Q K  HYRGVR RPWGK+AAEIRDP KNGARVWLGTY++ E AALAY KAAF MRG+KA LNFPH +G    +P RVT    LS +  S
Sbjct:  101 QPKGRHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYESAEEAALAYGKAAFRMRGTKALLNFPHRIGLNEPEPVRVTVKRRLSESASS 189          
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Match: EF101_ARATH (Ethylene-responsive transcription factor 2 OS=Arabidopsis thaliana GN=ERF2 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.328e-24
Identity = 56/89 (62.92%), Postives = 63/89 (70.79%), Query Frame = 1
Query:  391 KVVHYRGVRTRPWGKYAAEIRDPKKNGARVWLGTYDTPEGAALAYDKAAFEMRGSKAKLNFPHLLGRGNFKPGRVTPPTPLSVAHQSPS 657
            K  HYRGVR RPWGK+AAEIRDP KNGARVWLGT++T E AALAYD AAF MRGS+A LNFP  +  G   P R+T     S +  S S
Sbjct:  113 KAKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDIAAFRMRGSRALLNFPLRVNSGEPDPVRITSKRSSSSSSSSSS 201          
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Match: EF100_ARATH (Ethylene-responsive transcription factor 1A OS=Arabidopsis thaliana GN=ERF1A PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 3.970e-24
Identity = 53/76 (69.74%), Postives = 60/76 (78.95%), Query Frame = 1
Query:  388 AKVVHYRGVRTRPWGKYAAEIRDPKKNGARVWLGTYDTPEGAALAYDKAAFEMRGSKAKLNFPHLLGRGNFKPGRV 615
            AK  HYRGVR RPWGK+AAEIRDP KNGARVWLGT++T E AALAYD+AAF MRGS+A LNFP  +  G   P R+
Sbjct:  143 AKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPVRI 218          
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Match: EF112_ARATH (Ethylene-responsive transcription factor ERF112 OS=Arabidopsis thaliana GN=ERF112 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.339e-22
Identity = 50/75 (66.67%), Postives = 60/75 (80.00%), Query Frame = 1
Query:  352 QTAGLAARDRDQAKVVHYRGVRTRPWGKYAAEIRDPKKNGARVWLGTYDTPEGAALAYDKAAFEMRGSKAKLNFP 576
            Q++ L  +++  ++  +YRGVR RPWGK+AAEIRDP K  ARVWLGT+DT E AALAYDKAAFE RG KAKLNFP
Sbjct:   53 QSSSLTLQEKSNSRQRNYRGVRQRPWGKWAAEIRDPNK-AARVWLGTFDTAEEAALAYDKAAFEFRGHKAKLNFP 126          
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Match: EF113_ARATH (Ethylene-responsive transcription factor ERF113 OS=Arabidopsis thaliana GN=ERF113 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.844e-21
Identity = 53/93 (56.99%), Postives = 64/93 (68.82%), Query Frame = 1
Query:  376 DRDQAKVVHYRGVRTRPWGKYAAEIRDPKKNGARVWLGTYDTPEGAALAYDKAAFEMRGSKAKLNFPHLLGRGNFKPGRVTPPTPLSVAHQSP 654
            D+DQ +  HYRGVR RPWGK+AAEIRDPKK  ARVWLGT++T E AALAYD+AA + +G+KAKLNFP           RV  PT  +    +P
Sbjct:   30 DQDQPRRRHYRGVRQRPWGKWAAEIRDPKK-AARVWLGTFETAEEAALAYDRAALKFKGTKAKLNFPE----------RVQGPTTTTTISHAP 111          
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Match: EF105_ARATH (Ethylene-responsive transcription factor ERF105 OS=Arabidopsis thaliana GN=ERF105 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.109e-21
Identity = 50/79 (63.29%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  355 TAGLAARDRDQAKVVHYRGVRTRPWGKYAAEIRDPKKNGARVWLGTYDTPEGAALAYDKAAFEMRGSKAKLNFPHLLGR 591
            T     ++ DQ    HYRGVR RPWGKYAAEIRDP K G RVWLGT+DT   AA  YDKAAF++RGSKA LNFP   G+
Sbjct:   59 TTAPVVQENDQR---HYRGVRRRPWGKYAAEIRDPNKKGVRVWLGTFDTAMEAARGYDKAAFKLRGSKAILNFPLEAGK 134          
The following BLAST results are available for this feature:
BLAST of BQ623351 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
ERF99_ARATH2.403e-2974.03Ethylene-responsive transcription factor 13 OS=Ara... [more]
ERF1_TOBAC1.116e-2666.29Ethylene-responsive transcription factor 1 OS=Nico... [more]
ERF2_TOBAC3.248e-2675.34Ethylene-responsive transcription factor 2 OS=Nico... [more]
ERF2_NICSY3.248e-2675.34Ethylene-responsive transcription factor 2 OS=Nico... [more]
ERF1_SOLLC5.540e-2666.29Ethylene-responsive transcription factor 1 OS=Sola... [more]
EF101_ARATH2.328e-2462.92Ethylene-responsive transcription factor 2 OS=Arab... [more]
EF100_ARATH3.970e-2469.74Ethylene-responsive transcription factor 1A OS=Ara... [more]
EF112_ARATH6.339e-2266.67Ethylene-responsive transcription factor ERF112 OS... [more]
EF113_ARATH1.844e-2156.99Ethylene-responsive transcription factor ERF113 OS... [more]
EF105_ARATH4.109e-2163.29Ethylene-responsive transcription factor ERF105 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00442 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00442 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623351 ID=BQ623351|Name=BQ623351|organism=Citrus sinensis|type=EST|length=706bp
TTTTCAGAATCGGATTTTGATCTTCTTCAAAATCTTCTCGAGGACGTAAA
CACAGCCTCATCTTTTGAATCGGATTACTTAAACAATGCACCCTCCGTGT
ACTCACCAACTTCGAGCTTCGGCAGTGCCGTCTTTGATTTTCCACTACAA
GTAACAGGTAATGTTGTTATTAACAATAACAACAACTACCCAATCCCTTC
CTATGGCTGCTATGATCATCCCAAAGCCTTAAACGACGCCGTTGACAGCG
TGGGTTGGATTTCCTTTGATCATCATCAAGCTGATCAGGATGATCAAGCA
ATAAGCGAAGCCGCCGCAGCCGCCGCTACCCTTGATATGGTGACTTACCA
CCAGACGGCGGGGTTGGCAGCACGTGATCGTGATCAGGCGAAGGTGGTGC
ATTACAGGGGGGTGAGGACGAGGCCATGGGGGAAATATGCGGCTGAGATT
AGAGACCCTAAGAAGAACGGGGCACGTGTTTGGCTTGGCACTTATGATAC
CCCTGAGGGCGCAGCCTTGGCTTATGATAAAGCCGCGTTCGAGATGCGTG
GCTCTAAAGCTAAGCTTAATTTTCCTCACTTACTTGGCAGGGGTAATTTT
AAGCCCGGTCGTGTCACACCACCAACACCACTAAGCGTGGCTCACCAGAG
TCCGAGCCTGAGCTTTCTCCTACTTCTTCATCTTCTTCCTCTTCTTCGGC
TACTTC
back to top