BQ623353

Overview
NameBQ623353
Unique NameBQ623353
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9230 contig Csv1_Contig9230:445..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 4.872e-76
Identity = 138/161 (85.71%), Postives = 142/161 (88.20%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADPYTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTSL*FH 484
            GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWAD YTLFVLEMALMGFAEHRRFQDWA PGSMG+QYFLG EK LGGSGDPAY            KDEKSMK+ KLKE+KNGRLAMLAILGYF+Q LVTGVGPYQNLLDHLADPVNNNVLTSL FH
Sbjct:  113 GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGLGGSGDPAYPGGPLFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSLKFH 273          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 4.560e-74
Identity = 134/161 (83.23%), Postives = 140/161 (86.96%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADPYTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTSL*FH 484
            GAIAPE LGK GLIPQETALAWFQTGVIPPAGTYNYWAD YTLFVLEMALMGFAEHRRFQDWA PGSMG+QYFLG EK  GGSG+PAY            KDEKS+K+ KLKEVKNGRLAMLAILGYF+QGLVTGVGPYQNLLDH+ADPVNNNVLTSL FH
Sbjct:  115 GAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSLKFH 275          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.220e-18
Identity = 59/155 (38.06%), Postives = 80/155 (51.61%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADPYTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNNVL 466
            G + PE+  K G+I       W+       AG   Y+A   TLFV+E  L  + E RR+QD  NPGS+ +     F++Y    G+  Y              E      K KE+ NGRLAMLA LG+ VQ  VTG GP++NLL HL+DP +N ++
Sbjct:  109 GMLLPEVFTKIGII---NVPEWYD------AGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPI--FKQYSLPKGEVGYPGGIFNPLNFAPTQEA-----KEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIV 247          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.033e-17
Identity = 57/158 (36.08%), Postives = 81/158 (51.27%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADPYTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNNVLTSL 475
            G + PE+    G+I       W+       AG   Y+A   TLFV+E  L  + E RR+QD  NPGS+ +     F++Y   +G+  Y              E      K KE+ NGRLAMLA LG+ +Q  VTG GP+ NLL H++DP +N ++ +L
Sbjct:  108 GMLLPEVFTSIGII---NVPKWYA------AGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPI--FKQYSLPAGEVGYPGGIFNPLNFAPTLEA-----KEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTL 249          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 6.693e-17
Identity = 60/163 (36.81%), Postives = 83/163 (50.92%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PEIL K G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMGF E  R       G +G     G +K Y GG+ DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DH+ADPV NN
Sbjct:  111 GCVFPEILSKNGVTFGEAV--WFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYR----VGGGPLGE----GLDKIYPGGAFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHVADPVANN 253          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB25_SOLLC (Chlorophyll a-b binding protein 5, chloroplastic (Fragment) OS=Solanum lycopersicum GN=CAB5 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.741e-17
Identity = 60/163 (36.81%), Postives = 83/163 (50.92%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PEIL K G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMGF E  R       G +G     G +K Y GG+ DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DH+ADPV NN
Sbjct:   83 GCVFPEILSKNGVTFGEAV--WFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR----VGGGPLGE----GLDKIYPGGAFDPL----------GLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHIADPVANN 225          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.741e-17
Identity = 60/163 (36.81%), Postives = 83/163 (50.92%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PEIL K G+   E    WF+ G  I   G  +Y  +P          ++ +++ LMGF E  R       G +G     G +K Y GG+ DP               D  +  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DH+ADPV NN
Sbjct:  109 GCVFPEILSKNGVKFGEAV--WFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYR----VGGGPLGE----GLDKVYPGGAFDPL----------GLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN 251          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.741e-17
Identity = 60/163 (36.81%), Postives = 83/163 (50.92%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEK-YLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PEIL K G+   E    WF+ G  I   G  +Y  +P          ++ +++ LMGF E  R       G +G     G +K Y GG+ DP               D  +  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DH+ADPV NN
Sbjct:  109 GCVFPEILSKNGVKFGEAV--WFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYR----VGGGPLGE----GLDKVYPGGAFDPL----------GLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANN 251          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.741e-17
Identity = 60/162 (37.04%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGV-IPPAGTYNYWADP--------YTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLGGSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADPVNNN 460
            G + PE+L + G+   E    WF+ G  I   G  +Y  +P          ++  ++ LMG  E  R    A  G +G    L    Y GGS DP               D ++  + K+KE+KNGRLAM ++ G+FVQ +VTG GP +NL DHLADPVNNN
Sbjct:  111 GCVFPELLARNGVKFGEAV--WFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRV---AGEGPLGEAEDL---LYPGGSFDPL----------GLATDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 254          
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.741e-17
Identity = 56/165 (33.94%), Postives = 77/165 (46.67%), Query Frame = 2
Query:    2 GAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADPYTLFVLEMALMGFAEHRRFQDWANPGSMGRQYFLGFEKYLG----------------GSGDPAYXXXXXXXXXXXXKDEKSMKDFKLKEVKNGRLAMLAILGYFVQGLVTGVGPYQNLLDHLADP 448
            G   PE+L K G++      +W+       AG   Y+ D  TLF++E+ L+G+AE RR+ D   PG +         K  G                GSG PA                  +K+ + KE+KNGRLAMLA++G + Q + TG GP  NL  HLADP
Sbjct:  120 GIFIPELLTKIGIL---NTPSWYT------AGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPA-----------------KIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADP 258          
The following BLAST results are available for this feature:
BLAST of BQ623353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
CB13_SOLLC4.872e-7685.71Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB23_PEA4.560e-7483.23Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB24_ARATH1.220e-1838.06Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB24_PEA1.033e-1736.08Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB26_PETSP6.693e-1736.81Chlorophyll a-b binding protein 37, chloroplastic ... [more]
CB25_SOLLC8.741e-1736.81Chlorophyll a-b binding protein 5, chloroplastic (... [more]
CB23_ORYSJ8.741e-1736.81Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_ORYSI8.741e-1736.81Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_SINAL8.741e-1737.04Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB12_SOLLC8.741e-1733.94Chlorophyll a-b binding protein 7, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00444 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00444 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623353 ID=BQ623353|Name=BQ623353|organism=Citrus sinensis|type=EST|length=562bp
GGGAGCCATTGCACCGGAGATTCTTGGCAAGGCAGGCCTCATTCCGCAAG
AAACTGCCCTGGCCTGGTTCCAAACCGGTGTGATCCCCCCAGCGGGAACA
TACAACTACTGGGCAGACCCTTACACACTTTTCGTCCTGGAAATGGCACT
CATGGGATTTGCCGAGCACCGGAGATTCCAAGACTGGGCAAATCCAGGAT
CAATGGGCAGGCAATACTTCCTCGGATTCGAGAAATACTTGGGAGGATCC
GGCGATCCGGCTTACCCTGGAGGACCTCTATTCAACCCTCTGGGTCTTGG
GAAAGATGAGAAGTCAATGAAGGATTTCAAGCTCAAGGAAGTGAAGAATG
GAAGATTGGCAATGTTGGCAATCTTGGGTTACTTTGTTCAAGGTCTTGTT
ACAGGAGTTGGGCCTTACCAGAACCTATTGGATCACTTGGCTGATCCTGT
AAACAACAATGTTTTGACTAGCCTATAGTTTCACTGAGAGAGAAATTTCT
TGTTCATTGCTTTGGAATTATATATTCCAAGCCTTGTCATCCCCCACTCT
GTTCTATTCTAC
back to top