BQ623355

Overview
NameBQ623355
Unique NameBQ623355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4610 contig Csv1_Contig4610:525..1143. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 2.648e-76
Identity = 137/150 (91.33%), Postives = 141/150 (94.00%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKS 451
            LGAICGCG VKAFQ SYYTRYGGGANELADGY+ GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY+ EKAWDDQWIFWVGP IGAA AAFYHQFILRA+A KALGSF S
Sbjct:  134 LGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSFGS 283          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: PIP21_ARATH (Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 2.648e-76
Identity = 135/154 (87.66%), Postives = 144/154 (93.51%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSSNI 463
            LGAICG G VKAFQ SYYTRYGGGAN LADGYSTGTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY+K K WDD WIFWVGPFIGAAIAAFYHQF+LRAS SK+LGSF+S++N+
Sbjct:  134 LGAICGVGFVKAFQSSYYTRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAANV 287          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: PIP22_ARATH (Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2)

HSP 1 Score: 283.108 bits (723), Expect = 7.704e-76
Identity = 134/154 (87.01%), Postives = 143/154 (92.86%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSSNI 463
            LGAICG G VKAFQ SYY RYGGGAN LADGY+TGTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY+K K WDD WIFWVGPFIGAAIAAFYHQF+LRAS SK+LGSF+S++N+
Sbjct:  132 LGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAANV 285          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: PIP23_ARATH (Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3 PE=1 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 1.606e-73
Identity = 130/154 (84.42%), Postives = 141/154 (91.56%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSSNI 463
            LGAICG G VKAFQ S+Y  YGGGAN LADGY+TGTGL AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI++K K WDD WIFWVGPFIGA IAAFYHQF+LRAS SK+LGSF+S++N+
Sbjct:  132 LGAICGVGFVKAFQSSHYVNYGGGANFLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNKSKPWDDHWIFWVGPFIGATIAAFYHQFVLRASGSKSLGSFRSAANV 285          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: PIP21_MAIZE (Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2)

HSP 1 Score: 275.404 bits (703), Expect = 1.606e-73
Identity = 132/152 (86.84%), Postives = 141/152 (92.76%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS 457
            LGAICG GLVKAFQ +Y+ RYGGGAN LA GYS GTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY+K+K WDD WIFWVGP +GAAIAAFYHQ+ILRA A KALGSF+S++
Sbjct:  139 LGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKALGSFRSNA 290          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: PIP22_ORYSJ (Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 4.674e-73
Identity = 131/152 (86.18%), Postives = 143/152 (94.08%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS 457
            LGAICG GLVK FQ SYY RYGGGANEL+DGYS GTGLGAEIIGTFVLVYTVFSATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARSLG AVIY+K+KAWDDQWIFWVGP IGAAIAA YHQ++LRASA+K LGS++S++
Sbjct:  138 LGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGTAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSNA 288          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: PIP22_MAIZE (Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.776e-72
Identity = 128/152 (84.21%), Postives = 140/152 (92.11%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS 457
            LGA+CG GLVKAFQ +Y+ RYGGGAN LA GYS G GLGAEI+GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAV+Y+K+K WDD WIFWVGP +GAAIAAFYHQ+ILRA A KALGSF+S++
Sbjct:  141 LGAVCGVGLVKAFQSAYFDRYGGGANSLASGYSRGAGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILRAGAIKALGSFRSNA 292          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: PIP24_MAIZE (Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 5.168e-72
Identity = 130/152 (85.53%), Postives = 143/152 (94.08%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS 457
            LGAICG GLVK FQ +YY RYGGGANEL+DGYS GTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSLGAAVIY+K+KAWDDQWIFWVGP IGAAIAA YHQ++LRASA+K LGS++S++
Sbjct:  138 LGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK-LGSYRSNA 288          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: PIP23_MAIZE (Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 5.168e-72
Identity = 130/152 (85.53%), Postives = 143/152 (94.08%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS 457
            LGAICG GLVK FQ +YY RYGGGANEL+DGYS GTGL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSLGAAVIY+K+KAWDDQWIFWVGP IGAAIAA YHQ++LRASA+K LGS++S++
Sbjct:  139 LGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK-LGSYRSNA 289          
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Match: PIP25_ARATH (Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.151e-71
Identity = 127/154 (82.47%), Postives = 141/154 (91.56%), Query Frame = 2
Query:    2 LGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSSNI 463
            LGAICG  LVKAFQ +Y+TRYGGGAN L+DGYS GTG+ AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARSLGAA+IY+K+KAWD  WIFWVGPF GAAIAAFYHQF+LRA A KALGSF+S  ++
Sbjct:  133 LGAICGVALVKAFQSAYFTRYGGGANGLSDGYSIGTGVAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAIIYNKDKAWDHHWIFWVGPFAGAAIAAFYHQFVLRAGAIKALGSFRSQPHV 286          
The following BLAST results are available for this feature:
BLAST of BQ623355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 134
Match NameE-valueIdentityDescription
PIP24_ARATH2.648e-7691.33Probable aquaporin PIP2-4 OS=Arabidopsis thaliana ... [more]
PIP21_ARATH2.648e-7687.66Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1... [more]
PIP22_ARATH7.704e-7687.01Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2... [more]
PIP23_ARATH1.606e-7384.42Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3... [more]
PIP21_MAIZE1.606e-7386.84Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2[more]
PIP22_ORYSJ4.674e-7386.18Probable aquaporin PIP2-2 OS=Oryza sativa subsp. j... [more]
PIP22_MAIZE1.776e-7284.21Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1[more]
PIP24_MAIZE5.168e-7285.53Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1[more]
PIP23_MAIZE5.168e-7285.53Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1[more]
PIP25_ARATH1.151e-7182.47Probable aquaporin PIP2-5 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00446 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00446 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623355 ID=BQ623355|Name=BQ623355|organism=Citrus sinensis|type=EST|length=619bp
TTTGGGAGCCATATGTGGCTGCGGGCTCGTTAAGGCTTTCCAGAAGTCTT
ACTACACGAGATACGGCGGTGGAGCCAATGAGCTCGCTGATGGGTACAGC
ACTGGCACTGGATTGGGTGCTGAGATCATCGGTACCTTTGTTCTTGTCTA
CACTGTTTTCTCCGCCACTGATCCCAAGAGAAATGCTAGGGACTCCCACG
TTCCCGTCTTGGCGCCATTGCCAATTGGATTTGCTGTGTTCATGGTTCAC
TTGGCTACGATCCCTGTCACTGGAACTGGCATCAACCCCGCTAGAAGTTT
GGGAGCTGCAGTGATTTACAGCAAGGAGAAGGCTTGGGATGATCAATGGA
TCTTCTGGGTTGGCCCCTTCATTGGTGCTGCAATTGCTGCATTTTACCAC
CAATTCATCCTCAGAGCATCTGCTTCTAAAGCTCTTGGATCCTTCAAAAG
CTCCTCCAACATTTAATTAACTTTTAAAATAATTACTGGAGGATTAATCA
ATGGCTGTCAAGCGGCTTCGCGACTATGGAATTTGTACATTGTTTTATTT
GCATCAGTATTTAGTATAGCTGGTGTAGATCCCGCAGCACTTTGTGTGTG
TCTTTTGTTTACCTGAGGA
back to top