BQ623587

Overview
NameBQ623587
Unique NameBQ623587
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length379
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5674 contig Csv1_Contig5674:143..521. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623587 vs. ExPASy Swiss-Prot
Match: PSAG_ARATH (Photosystem I reaction center subunit V, chloroplastic OS=Arabidopsis thaliana GN=PSAG PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.196e-33
Identity = 71/113 (62.83%), Postives = 90/113 (79.65%), Query Frame = 1
Query:   43 ASSSLFTPSTITVRKHQISPSSISFQGLRPLNTR-AKTPLPKLATSAKRNSFGGIKAELNTPLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDVRAKEYV 378
            ++S+L +P+T +      +P+SISF GLRPL    + + LPKL+T+ +++S   ++AEL+  +VISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNG THFEAGD RAKEYV
Sbjct:    4 SASALLSPTTFSTAISHKNPNSISFHGLRPLRLGGSSSALPKLSTTGRKSSSAVVRAELSPSIVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGKTHFEAGDDRAKEYV 116          
BLAST of BQ623587 vs. ExPASy Swiss-Prot
Match: PSAG_SPIOL (Photosystem I reaction center subunit V, chloroplastic OS=Spinacia oleracea GN=PSAG PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 6.605e-23
Identity = 60/91 (65.93%), Postives = 69/91 (75.82%), Query Frame = 1
Query:  112 SFQGLRPL--NTRAKTPLPKLATSAKRNSFGGIKAELNTPLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDVRAKEYV 378
            SF GLRPL  N  +      L+ S+ R S    +AEL+  LVISLSTGLSLFLGRFVFFNFQREN+AKQ +PEQNG++HFEAGD RAKEYV
Sbjct:   36 SFSGLRPLKLNISSNNSSSSLSMSSARRSMT-CRAELSPSLVISLSTGLSLFLGRFVFFNFQRENMAKQ-VPEQNGMSHFEAGDTRAKEYV 124          
BLAST of BQ623587 vs. ExPASy Swiss-Prot
Match: PSAG_HORVU (Photosystem I reaction center subunit V, chloroplastic OS=Hordeum vulgare GN=PSAG PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 8.356e-18
Identity = 52/94 (55.32%), Postives = 66/94 (70.21%), Query Frame = 1
Query:   94 ISPSSISFQGLRPLNTRAKTPLPKLATSAKRNSFGGIKAELNTPLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDVRAKEY 375
            +SP +++   L P + RA      ++  A+R+     +A L   +VISLSTGLSL +GRFVFFNFQRENVAKQ +PEQNG THFEAGD RAKE+
Sbjct:    9 LSPPAVAGLRLAP-SPRAAASFRGVSPPARRSV--AARAALEPSVVISLSTGLSLVMGRFVFFNFQRENVAKQ-VPEQNGKTHFEAGDERAKEF 98          
BLAST of BQ623587 vs. ExPASy Swiss-Prot
Match: PSAG_PEA (Photosystem I reaction center subunit V (Fragment) OS=Pisum sativum GN=PSAG PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.130e-13
Identity = 37/39 (94.87%), Postives = 37/39 (94.87%), Query Frame = 1
Query:  211 ELNTPLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQ 327
            ELN  LVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQ
Sbjct:    1 ELNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQ 39          
The following BLAST results are available for this feature:
BLAST of BQ623587 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
PSAG_ARATH9.196e-3362.83Photosystem I reaction center subunit V, chloropla... [more]
PSAG_SPIOL6.605e-2365.93Photosystem I reaction center subunit V, chloropla... [more]
PSAG_HORVU8.356e-1855.32Photosystem I reaction center subunit V, chloropla... [more]
PSAG_PEA2.130e-1394.87Photosystem I reaction center subunit V (Fragment)... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00678 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00678 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623587 ID=BQ623587|Name=BQ623587|organism=Citrus sinensis|type=EST|length=379bp
ACAAAAAAGAAGGAAAAAGAGGGGAAAAAAAGAAAAATGGCAGCCTCATC
CTCCTTGTTCACACCCTCCACCATCACCGTCCGAAAACACCAAATTTCAC
CCTCCAGCATCTCATTCCAAGGCCTAAGACCCCTCAACACCAGGGCCAAA
ACCCCCCTCCCCAAGCTCGCCACCTCCGCCAAAAGAAACAGCTTCGGCGG
CATTAAAGCTGAGCTGAACACACCACTTGTCATCAGCCTCAGCACTGGCC
TCTCCTTGTTCTTGGGCAGGTTCGTCTTCTTCAACTTCCAAAGAGAGAAC
GTGGCCAAACAAGGCTTGCCCGAGCAGAATGGAGTCACCCACTTTGAAGC
CGGTGATGTTCGTGCCAAGGAATATGTTA
back to top