BQ623590

Overview
NameBQ623590
Unique NameBQ623590
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length637
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10901 contig Csv1_Contig10901:708..1345. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Match: G3PA_ARATH (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Arabidopsis thaliana GN=GAPA PE=1 SV=3)

HSP 1 Score: 273.863 bits (699), Expect = 8.909e-76
Identity = 142/199 (71.36%), Postives = 148/199 (74.37%), Query Frame = 2
Query:    2 EGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXXXXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSPL 598
            EGTGVFVDREGAGKHI+AGAKKV+ITAPGKGDIPTYVVGVNADAY  DEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQ                  NIVPTST                 NGIALRVPTPN          SKKTFAEEVNAAFR+SA+ ELKGIL VCDEPLVSVDFRCSD S+ +
Sbjct:  157 EGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTI 355          

HSP 2 Score: 31.187 bits (69), Expect = 8.909e-76
Identity = 13/15 (86.67%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  592 TVDSSLTLVMGDDMV 636
            T+DSSLT+VMGDDMV
Sbjct:  354 TIDSSLTMVMGDDMV 368          
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Match: G3PA_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPA PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.977e-75
Identity = 143/197 (72.59%), Postives = 145/197 (73.60%), Query Frame = 2
Query:    2 EGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXXXXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSS 592
            EGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAD Y PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQ                  NIVPTST                   + LRVPTPN          SKKTFAEEVNAAFRE+AD ELKGIL VCDEPLVSVDFRCSDVSS
Sbjct:  153 EGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALSSQALRGSSMALPLRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSS 349          

HSP 2 Score: 30.4166 bits (67), Expect = 1.977e-75
Identity = 13/15 (86.67%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  592 TVDSSLTLVMGDDMV 636
            TVD+SLT+VMGDDMV
Sbjct:  350 TVDASLTMVMGDDMV 364          
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Match: G3PA_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 1.655e-74
Identity = 142/199 (71.36%), Postives = 145/199 (72.86%), Query Frame = 2
Query:    2 EGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXXXXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSPL 598
            EGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAD Y PDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQ                  NIVPTST                 NGIALRVPTPN          SKKT AEEVN AFR++A NEL GIL VCD PLVSVDFRCSDVSS +
Sbjct:  164 EGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVSSTI 362          

HSP 2 Score: 30.0314 bits (66), Expect = 1.655e-74
Identity = 12/15 (80.00%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  592 TVDSSLTLVMGDDMV 636
            T+D+SLT+VMGDDMV
Sbjct:  361 TIDASLTMVMGDDMV 375          
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Match: G3PA_SPIOL (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2)

HSP 1 Score: 269.24 bits (687), Expect = 2.158e-74
Identity = 140/199 (70.35%), Postives = 147/199 (73.87%), Query Frame = 2
Query:    2 EGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXXXXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSPL 598
            EGTGVFVDR+GAGKH+QAGAKKVLITAPGKGDIPTYVVGVN + Y   + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQ                  NIVPTST                 NGIALRVPTPN          SKKTFAEEVNAAFRESADNELKGILSVCDEPLVS+DFRC+DVSS +
Sbjct:  162 EGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTI 360          

HSP 2 Score: 31.187 bits (69), Expect = 2.158e-74
Identity = 13/15 (86.67%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  592 TVDSSLTLVMGDDMV 636
            T+DSSLT+VMGDDMV
Sbjct:  359 TIDSSLTMVMGDDMV 373          
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Match: G3PA_PEA (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2)

HSP 1 Score: 263.077 bits (671), Expect = 2.571e-72
Identity = 140/197 (71.07%), Postives = 143/197 (72.59%), Query Frame = 2
Query:    2 EGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXXXXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSS 592
            EGTGVFVDREGAG+HI AGAKKVLITAPGKGDIPTYVVGVNADAY   + IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQ                  NIVPTST                 NGIALRVPTPN          SKKTFAEEVN AFRESA  EL GILSVCDEPLVSVDFRC+DVSS
Sbjct:  166 EGTGVFVDREGAGRHITAGAKKVLITAPGKGDIPTYVVGVNADAYTHADDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRESAAKELTGILSVCDEPLVSVDFRCTDVSS 362          

HSP 2 Score: 30.4166 bits (67), Expect = 2.571e-72
Identity = 13/15 (86.67%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  592 TVDSSLTLVMGDDMV 636
            TVDSSLT+VMGDD+V
Sbjct:  363 TVDSSLTMVMGDDLV 377          
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Match: G3PA_SINAL (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Sinapis alba GN=GAPA PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 5.233e-70
Identity = 133/192 (69.27%), Postives = 140/192 (72.92%), Query Frame = 2
Query:   23 DREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXXXXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSPL 598
            DREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNA+ Y  ++ IISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQ                  NIVPTST                 NGIALRVPTPN          SKKTFAEEVNAAFR++A+ ELKGIL VCDEPLVSVDFRCSDVSS +
Sbjct:    1 DREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTI 192          

HSP 2 Score: 31.187 bits (69), Expect = 5.233e-70
Identity = 13/15 (86.67%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  592 TVDSSLTLVMGDDMV 636
            T+DSSLT+VMGDDMV
Sbjct:  191 TIDSSLTMVMGDDMV 205          
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Match: G3PA_SCEVA (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Scenedesmus vacuolatus GN=GapA PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 9.559e-63
Identity = 123/200 (61.50%), Postives = 136/200 (68.00%), Query Frame = 2
Query:    2 EGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVVGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXXXXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSPL 598
            EGTGVF+D  GA KHI+AGAKKVLITAP KG DIPTYVVGVNA  YK  + IISNASCTTNCLAPFVKVLD+KFGI+KGTMT THSYTGDQ                  NIVPT+T                 NGIALRVPTPN           KKTFAEE+N AF+E+A   L G+L+V DEPLVSVDFRC+DVSS +
Sbjct:   91 EGTGVFIDTPGASKHIEAGAKKVLITAPAKGSDIPTYVVGVNAHDYKHSDAIISNASCTTNCLAPFVKVLDEKFGIVKGTMTNTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEINNAFKEAAAGSLNGVLAVSDEPLVSVDFRCTDVSSTI 290          

HSP 2 Score: 28.1054 bits (61), Expect = 9.559e-63
Identity = 12/15 (80.00%), Postives = 14/15 (93.33%), Query Frame = 1
Query:  592 TVDSSLTLVMGDDMV 636
            T+DSSLT+VMG DMV
Sbjct:  289 TIDSSLTMVMGADMV 303          
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Match: G3PB_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 6.107e-62
Identity = 125/202 (61.88%), Postives = 138/202 (68.32%), Query Frame = 2
Query:    2 EGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVVGVNADAYKPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXXXXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTF-AEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSPL 598
            EGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNASCTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQ                  NIVPTST                 NGIALRVPTPN          +KK   AE+VNAAFR++AD  LKG+L+VCDEPLVSVDFRCSDVSS +
Sbjct:  150 EGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNASCTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAVCDEPLVSVDFRCSDVSSTI 351          

HSP 2 Score: 31.187 bits (69), Expect = 6.107e-62
Identity = 13/15 (86.67%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  592 TVDSSLTLVMGDDMV 636
            T+DSSLT+VMGDDMV
Sbjct:  350 TIDSSLTMVMGDDMV 364          
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Match: G3PA_CHLRE (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Chlamydomonas reinhardtii GN=GAPA PE=1 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 3.918e-61
Identity = 120/200 (60.00%), Postives = 136/200 (68.00%), Query Frame = 2
Query:    2 EGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVVGVNADAYKPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXXXXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSPL 598
            EGTGVF+D+ GAGKHIQAGA KVLITAP K  DIPT+VVGVN   YK + PIISNASCTTNCLAPFVKVL+QKFGI+KGTMTTTHSYTGDQ                  NIVPT+T                 NGIALRVPTP            KKTFAEEVNAAFRE+A+  +KG+L V D PLVS+DF+C+D S+ +
Sbjct:  133 EGTGVFIDKVGAGKHIQAGASKVLITAPAKDKDIPTFVVGVNEGDYKHEYPIISNASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQSTSI 332          

HSP 2 Score: 28.4906 bits (62), Expect = 3.918e-61
Identity = 11/15 (73.33%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  592 TVDSSLTLVMGDDMV 636
            ++D+SLT+VMGDDMV
Sbjct:  331 SIDASLTMVMGDDMV 345          
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Match: G3PB_PEA (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.922e-60
Identity = 123/202 (60.89%), Postives = 136/202 (67.33%), Query Frame = 2
Query:    2 EGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVVGVNADAYKPD-EPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQXXXXXXXXXXXXXXXXXXNIVPTSTXXXXXXXXXXXXXXXXXNGIALRVPTPNXXXXXXXXXXSKKTF-AEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSPL 598
            EGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV+GVN   Y  +   IISNASCTTNCLAPF KVLD++FGI+KGTMTTTHSYTGDQ                  NIVPTST                 NGIALRVPTPN          +KK   AE+VNAAFR++A+  LKGIL VCD PLVSVDFRCSDVS+ +
Sbjct:  181 EGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGILDVCDVPLVSVDFRCSDVSTTI 382          

HSP 2 Score: 31.187 bits (69), Expect = 1.922e-60
Identity = 13/15 (86.67%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  592 TVDSSLTLVMGDDMV 636
            T+DSSLT+VMGDDMV
Sbjct:  381 TIDSSLTMVMGDDMV 395          
The following BLAST results are available for this feature:
BLAST of BQ623590 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 348
Match NameE-valueIdentityDescription
G3PA_ARATH8.909e-7671.36Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_TOBAC1.977e-7572.59Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_MAIZE1.655e-7471.36Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_SPIOL2.158e-7470.35Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_PEA2.571e-7271.07Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_SINAL5.233e-7069.27Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_SCEVA9.559e-6361.50Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PB_TOBAC6.107e-6261.88Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PA_CHLRE3.918e-6160.00Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PB_PEA1.922e-6060.89Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00681 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00681 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623590 ID=BQ623590|Name=BQ623590|organism=Citrus sinensis|type=EST|length=637bp
TGAAGGGACAGGAGTGTTTGTAGACAGAGAGGGTGCGGGCAAGCACATTC
AGGCTGGTGCCAAGAAAGTACTTATTACAGCCCCCGGCAAGGGTGACATC
CCAACCTACGTTGTTGGTGTCAATGCGGATGCTTACAAACCAGATGAGCC
CATCATCAGCAATGCTTCTTGCACAACCAACTGCCTTGCCCCATTCGTCA
AGGTTCTTGACCAGAAGTTTGGCATTATCAAGGGAACCATGACCACCACA
CACTCGTACACTGGCGACCAAAGACTACTCGATGCTAGCCACCGTGACCT
CAGGCGTGCAAGAGCAGCTGCACTCAACATTGTCCCAACATCAACTGGTG
CGGCAAAAGCTGTGGCCCTTGTCCTCCCAGCACTCAAAGGCAAACTAAAC
GGCATTGCCCTTCGTGTGCCAACACCAAACGTCTCGGTTGTTGATCTTGT
CGTTCAGGTGTCCAAGAAAACCTTCGCAGAAGAGGTGAACGCCGCCTTCA
GAGAAAGCGCTGACAATGAGCTGAAAGGCATCCTCTCCGTGTGCGACGAG
CCCCTTGTTTCGGTCGACTTCAGGTGCTCTGATGTATCCTCACCGTTGAT
TCATCTCTCACACTTGTCATGGGAGACGACATGGTTA
back to top