BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y2706_ARATH (Probable receptor-like protein kinase At2g47060 OS=Arabidopsis thaliana GN=At2g47060 PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 1.366e-68
Identity = 126/141 (89.36%), Postives = 129/141 (91.49%), Query Frame = 3
Query:    3 HIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEADF 425
            HIIHRDIKSSNVL+F+DDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDH LPRGQQSLVTWATPKLSEDKV+QCVDARLGGDYPP           LCVQYEADF
Sbjct:  198 HIIHRDIKSSNVLLFEDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHRLPRGQQSLVTWATPKLSEDKVKQCVDARLGGDYPPKAVAKLAAVAALCVQYEADF 338          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: PTI1_SOLLC (Pto-interacting protein 1 OS=Solanum lycopersicum GN=PTI1 PE=1 SV=2)

HSP 1 Score: 251.521 bits (641), Expect = 9.791e-67
Identity = 122/141 (86.52%), Postives = 128/141 (90.78%), Query Frame = 3
Query:    3 HIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEADF 425
            HIIHRDIKSSN+L+FDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQL++KSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATP+LSEDKV+QCVDARL  DYPP           LCVQYEADF
Sbjct:  193 HIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLNTDYPPKAIAKMAAVAALCVQYEADF 333          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y2197_ARATH (Probable protein kinase At2g41970 OS=Arabidopsis thaliana GN=At2g41970 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 6.361e-58
Identity = 104/140 (74.29%), Postives = 120/140 (85.71%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEADF 425
            I+HRD++SSNVL+FDD VAK+ADF+L+N + D AARLHSTRVLGTFGYHAPEYAMTGQ+  KSDVYSFGVVLLELLTGRKPVDHT+P+GQQSLVTWATP+LSEDKV+QC+D +L  D+PP           LCVQYEADF
Sbjct:  200 IVHRDVRSSNVLLFDDFVAKMADFNLTNASSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCIDPKLNNDFPPKAVAKLAAVAALCVQYEADF 339          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y3545_ARATH (Probable receptor-like protein kinase At3g55450 OS=Arabidopsis thaliana GN=At3g55450 PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.519e-30
Identity = 70/138 (50.72%), Postives = 86/138 (62.32%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKL-SEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYE 416
            +I+RDIK+SN+L+  D  AK++DF L+   P       STRV+GTFGY APEY  TG LNA+SDVYSFGVVLLELL GR+ +DH  P  +Q+LV WA P L S  KV   VD RL   Y P            C+ +E
Sbjct:  193 VIYRDIKASNILLDSDFNAKLSDFGLARDGPMGEQSYVSTRVMGTFGYAAPEYVSTGHLNARSDVYSFGVVLLELLCGRQALDHNRPAKEQNLVDWARPYLTSRRKVLLIVDTRLNSQYKPEGAVRLASIAVQCLSFE 330          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: PBS1_ARATH (Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.132e-29
Identity = 66/139 (47.48%), Postives = 88/139 (63.31%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSE-DKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEA 419
            +I+RD KSSN+L+ +    K++DF L+   P       STRV+GT+GY APEYAMTGQL  KSDVYSFGVV LEL+TGRK +D  +P G+Q+LV WA P  ++  K  +  D RL G +P            +C+Q +A
Sbjct:  209 VIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKSHVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQA 347          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: RLCK7_ARATH (Probable serine/threonine-protein kinase RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.021e-28
Identity = 65/136 (47.79%), Postives = 86/136 (63.24%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDK-VRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            +I+RD+K SN+L+ +D   K++DF L+   P       STRV+GT+GY AP+YAMTGQL  KSD+YSFGVVLLEL+TGRK +D+T  R  Q+LV WA P   + +   + VD  L G YP            +CVQ
Sbjct:  226 VIYRDLKCSNILLGEDYQPKLSDFGLAKVGPSGDKTHVSTRVMGTYGYCAPDYAMTGQLTFKSDIYSFGVVLLELITGRKAIDNTKTRKDQNLVGWARPLFKDRRNFPKMVDPLLQGQYPVRGLYQALAISAMCVQ 361          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: SRF8_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsis thaliana GN=SRF8 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.996e-27
Identity = 63/141 (44.68%), Postives = 93/141 (65.96%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSE-DKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYEADF 425
            I+HR+ KS+N+L+ ++    ++D  L+   P+   ++ ST+V+G+FGY APE+A++G    KSDVY+FGVV+LELLTGRKP+D +  R +QSLV WATP+L + D + + VD  L G YP            LC+Q E +F
Sbjct:  519 IVHRNFKSANILLDEELNPHLSDSGLAALTPNTERQV-STQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEF 658          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: BIK1_ARATH (Serine/threonine-protein kinase BIK1 OS=Arabidopsis thaliana GN=BIK1 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.996e-27
Identity = 64/138 (46.38%), Postives = 88/138 (63.77%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKL-SEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQYE 416
            +I+RDIK+SN+L+  D  AK++DF L+   P       STRV+GT+GY APEY  +G LNA+SDVYSFGV+LLE+L+G++ +DH  P  +++LV WA P L S+ KV   VD RL   Y P            C+ +E
Sbjct:  198 VIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFE 335          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: APK2B_ARATH (Protein kinase 2B, chloroplastic OS=Arabidopsis thaliana GN=APK2B PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.294e-26
Identity = 62/120 (51.67%), Postives = 84/120 (70.00%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSED-KVRQCVDARLGGDYP 362
            +I+RD K++N+L+  +  +K++DF L+   P       ST+V+GT GY APEY  TG+L AKSDVYSFGVVLLELL+GR+ VD +    +QSLV WATP L +  K+ + +D RLGG YP
Sbjct:  212 VIYRDFKAANILLDAEFNSKLSDFGLAKAGPTGDKTHVSTQVMGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKSKVGMEQSLVDWATPYLGDKRKLFRIMDTRLGGQYP 331          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: APK2A_ARATH (Protein kinase 2A, chloroplastic OS=Arabidopsis thaliana GN=APK2A PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.882e-26
Identity = 60/120 (50.00%), Postives = 84/120 (70.00%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSED-KVRQCVDARLGGDYP 362
            +I+RD K++N+L+  D  AK++DF L+   P       ST+V+GT GY APEY  TG+L AKSDVYSFGVVLLEL++GR+ +D++    + SLV WATP L +  K+ + +D +LGG YP
Sbjct:  215 VIYRDFKAANILLDADFNAKLSDFGLAKAGPTGDNTHVSTKVIGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELISGRRAMDNSNGGNEYSLVDWATPYLGDKRKLFRIMDTKLGGQYP 334          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
Y2706_ARATH1.366e-6889.36Probable receptor-like protein kinase At2g47060 OS... [more]
PTI1_SOLLC9.791e-6786.52Pto-interacting protein 1 OS=Solanum lycopersicum ... [more]
Y2197_ARATH6.361e-5874.29Probable protein kinase At2g41970 OS=Arabidopsis t... [more]
Y3545_ARATH2.519e-3050.72Probable receptor-like protein kinase At3g55450 OS... [more]
PBS1_ARATH2.132e-2947.48Serine/threonine-protein kinase PBS1 OS=Arabidopsi... [more]
RLCK7_ARATH4.021e-2847.79Probable serine/threonine-protein kinase RLCKVII O... [more]
SRF8_ARATH1.996e-2744.68Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsi... [more]
BIK1_ARATH1.996e-2746.38Serine/threonine-protein kinase BIK1 OS=Arabidopsi... [more]
APK2B_ARATH1.294e-2651.67Protein kinase 2B, chloroplastic OS=Arabidopsis th... [more]
APK2A_ARATH2.882e-2650.00Protein kinase 2A, chloroplastic OS=Arabidopsis th... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top