BQ623595

Overview
NameBQ623595
Unique NameBQ623595
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length417
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1379 contig Csv1_Contig1379:31..446. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623595 vs. ExPASy Swiss-Prot
Match: MLP43_ARATH (MLP-like protein 43 OS=Arabidopsis thaliana GN=MLP43 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.644e-24
Identity = 57/131 (43.51%), Postives = 76/131 (58.02%), Query Frame = 3
Query:   27 AKNMTLSGQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPK-GEHSCLG--SLDYQV*EEE 410
            A+  +L G+LETE+E K SA  FH + + RPHH S  TPD + G ELHEG+WGK G+++ W Y HDG                N  TFKV+EG L+++Y SF  T+Q  PK GE   +    L+Y+   EE
Sbjct:    2 AEASSLVGKLETEVEIKASAKKFHHMFTERPHHVSKATPDKIHGCELHEGDWGKVGSIVIWKYVHDGKLTVGKNKIEAVDPEKNLITFKVLEGDLMNEYKSFAFTLQVTPKQGESGSIAHWHLEYEKISEE 132          
BLAST of BQ623595 vs. ExPASy Swiss-Prot
Match: MLP31_ARATH (MLP-like protein 31 OS=Arabidopsis thaliana GN=MLP31 PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 2.644e-24
Identity = 50/110 (45.45%), Postives = 67/110 (60.91%), Query Frame = 3
Query:   30 KNMTLSGQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPK 359
            ++ +L G+LET++E K SA  FH + + RPHH S  TP  +QG ELHEG+WGK G+++ W Y HDG                N  TF+VIEG LL +Y SF +T+Q  PK
Sbjct:   16 ESSSLCGKLETDIEIKASAGKFHHMFAGRPHHVSKATPGKIQGCELHEGDWGKVGSIVFWNYVHDGEAKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTPK 125          
BLAST of BQ623595 vs. ExPASy Swiss-Prot
Match: MLP34_ARATH (MLP-like protein 34 OS=Arabidopsis thaliana GN=MLP34 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 7.200e-22
Identity = 48/116 (41.38%), Postives = 68/116 (58.62%), Query Frame = 3
Query:   39 TLSGQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPKGEHSCLGSL 386
            +L G+LETE+E K SA  FH + + +PHH S  +P ++Q  +LHEG+WG  G+++ W Y HDG                N  TF+VIEG L+ +Y SF +T+Q  PK  H   GS+
Sbjct:    8 SLVGKLETEVEIKASAGQFHHMFAGKPHHVSKASPGNIQSCDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPK--HGGPGSI 121          

HSP 2 Score: 101.679 bits (252), Expect = 1.228e-21
Identity = 49/126 (38.89%), Postives = 70/126 (55.56%), Query Frame = 3
Query:    9 EYLF*SAKNMTLSGQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPKGEHSCLGSL 386
            E+L    + +  +  LETE+E K SA  FH + + +PHH S  TP ++Q  +LHEG+WG  G+++ W Y HDG                N  TF+VIEG L+ +Y SF +T+Q  PK  H   GS+
Sbjct:  154 EHLLSEEEEVKTTETLETEVEIKASAEKFHHMFAGKPHHVSKATPGNIQSCDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVDPEKNLITFRVIEGDLMKEYKSFVITIQVTPK--HGGSGSV 277          
BLAST of BQ623595 vs. ExPASy Swiss-Prot
Match: MLP28_ARATH (MLP-like protein 28 OS=Arabidopsis thaliana GN=MLP28 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 7.200e-22
Identity = 45/107 (42.06%), Postives = 65/107 (60.75%), Query Frame = 3
Query:   39 TLSGQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPK 359
            +L G+LET++E K SA  FH + + +PHH S  +P ++QG +LHEG+WG  G+++ W Y HDG                N  TF+VIEG L+ +Y SF +T+Q  PK
Sbjct:   21 SLVGKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPK 127          

HSP 2 Score: 98.9821 bits (245), Expect = 7.960e-21
Identity = 43/107 (40.19%), Postives = 65/107 (60.75%), Query Frame = 3
Query:   39 TLSGQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPK 359
            +L G+LET++E K SA  FH + + +PHH S  +P ++QG +LHEG+WG+ G+++ W Y HD                 N  TF+VI+G L+ +Y SF +T+Q  PK
Sbjct:  183 SLVGKLETDVEIKASAEKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGQVGSIVFWNYVHDREAKVAKERIEAVEPNKNLITFRVIDGDLMKEYKSFLLTIQVTPK 289          
The following BLAST results are available for this feature:
BLAST of BQ623595 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
MLP43_ARATH2.644e-2443.51MLP-like protein 43 OS=Arabidopsis thaliana GN=MLP... [more]
MLP31_ARATH2.644e-2445.45MLP-like protein 31 OS=Arabidopsis thaliana GN=MLP... [more]
MLP34_ARATH7.200e-2241.38MLP-like protein 34 OS=Arabidopsis thaliana GN=MLP... [more]
MLP28_ARATH7.200e-2242.06MLP-like protein 28 OS=Arabidopsis thaliana GN=MLP... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00686 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00686 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623595 ID=BQ623595|Name=BQ623595|organism=Citrus sinensis|type=EST|length=417bp
TTCCTTGTGAATATCTATTTTAATCCGCTAAAAACATGACCCTATCTGGT
CAGTTGGAGACTGAATTAGAGGCCAAGGTTTCGGCTAGTATTTTTCATGA
TGTGCTTAGCTGCAGGCCACACCATTTCTCCAATATGACTCCTGATCATG
TACAAGGTGTTGAACTGCACGAAGGTGAATGGGGAAAACCAGGCACTGTC
ATTACCTGGACTTATAAGCATGATGGGGTTACAGAAATTGCCAAGGAGAT
AATTGAAGAAATAGATGACGAAAAGAACTCGACAACTTTTAAAGTAATTG
AAGGGCATCTACTGGACAAGTACAGCAGCTTCTATGTTACCGTTCAAGCC
ATTCCGAAGGGTGAACATAGTTGCCTTGGCTCGTTGGACTATCAAGTATG
AGAAGAAGAGCGAGGAC
back to top