BQ623597

Overview
NameBQ623597
Unique NameBQ623597
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length426
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6849 contig Csv1_Contig6849:289..714. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Match: HSP17_ARATH (17.4 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.4A PE=1 SV=2)

HSP 1 Score: 196.823 bits (499), Expect = 2.862e-50
Identity = 92/130 (70.77%), Postives = 108/130 (83.08%), Query Frame = 3
Query:   36 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKA 425
            MSL+PS FGGRRTNVFDPFSLDVWDPF+GFL+  LTNAP  A++ + F NA++DW+ETP+AHVFKAD+PGL+          G ILQISGERS E EEK+D WHRVERSSGKF+RRFRLP+NAKVE+VKA
Sbjct:    1 MSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAP--AKDVAAFTNAKVDWRETPEAHVFKADVPGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKA 128          
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Match: HS181_ARATH (18.1 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 1.420e-49
Identity = 95/132 (71.97%), Postives = 110/132 (83.33%), Query Frame = 3
Query:   36 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFL--SSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKA 425
            MSLIPSIFGGRR+NVFDPFS D+WDPF+GF   SSAL NA S+AR+ + F NAR+DWKETP+AHVFKADLPGL+            +LQISGERSKE EEKNDKWHRVER+SGKF+RRFRLP+NAK+E+VKA
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSQDLWDPFEGFFTPSSALANA-STARDVAAFTNARVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRRFRLPENAKMEEVKA 131          
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Match: HS17C_ARATH (17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 4.133e-49
Identity = 95/131 (72.52%), Postives = 108/131 (82.44%), Query Frame = 3
Query:   36 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLS-SALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKA 425
            MSLIPSIFGGRRTNVFDPFSLDV+DPF+GFL+ S L NAP  A + + F NA++DW+ETP+AHVFKADLPGLR          G ILQISGERS E EEKNDKWHRVERSSGKF RRFRLP+NAK+E++KA
Sbjct:    1 MSLIPSIFGGRRTNVFDPFSLDVFDPFEGFLTPSGLANAP--AMDVAAFTNAKVDWRETPEAHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKA 129          
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Match: HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.329e-47
Identity = 90/130 (69.23%), Postives = 104/130 (80.00%), Query Frame = 3
Query:   36 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKA 425
            MS+IPS FGGRR+NVFDPFSLDVWDPF  F     ++A    +ET+ F N  IDWKETPQAHVFKADLPGL+          G++LQISGER+KE+EEKNDKWHRVERSSGKFLRRFRLP+NAKV++VKA
Sbjct:    1 MSIIPSFFGGRRSNVFDPFSLDVWDPFKDF-PLVTSSASEFGKETAAFVNTHIDWKETPQAHVFKADLPGLKKEEVKVELEEGKVLQISGERNKEKEEKNDKWHRVERSSGKFLRRFRLPENAKVDEVKA 129          
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Match: HSP12_MEDSA (18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 2.772e-45
Identity = 85/130 (65.38%), Postives = 102/130 (78.46%), Query Frame = 3
Query:   36 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKA 425
            MSLIPS FGGRR+NVFDPFSLDVWDPF  F  +    + S  RE S F + R+DWKETP+AHVFKADLPG++           R+LQISGERS E+E+KND+WHR+ERSSGKF+RRFRLP+NAK++QVKA
Sbjct:    1 MSLIPSFFGGRRSNVFDPFSLDVWDPFKDFPFNNSALSASFPRENSAFVSTRVDWKETPEAHVFKADLPGMKKEEVKVEIEDDRVLQISGERSVEKEDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKA 130          
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 3.620e-45
Identity = 89/135 (65.93%), Postives = 104/135 (77.04%), Query Frame = 3
Query:   36 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGF-----LSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKA 425
            MSLIP+ FGGRR NVFDPFSLDVWDPF  F     LSSA  + P  +RE S F + R+DWKETP+AHVFKAD+PGL+           ++LQISGER+ E+E+KND WHRVERSSGKF+RRFRLP+NAKVEQVKA
Sbjct:    1 MSLIPNFFGGRRNNVFDPFSLDVWDPFKDFPFPNTLSSA--SFPEFSRENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKA 133          
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Match: HSP13_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.065e-44
Identity = 87/131 (66.41%), Postives = 102/131 (77.86%), Query Frame = 3
Query:   36 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKA 425
            MSLIPSIFGGRR+NVFDPFSLDVWDPF  F      + P+S + E S F N R+DWKETP+AHVF+AD+PGL+           R+LQISGER+ E+E+KND WHRVERSSG F+RRFRLP+NAKVEQVKA
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSLDVWDPFKDF------HFPTSLSAENSAFVNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDDRVLQISGERNLEKEDKNDTWHRVERSSGNFMRRFRLPENAKVEQVKA 125          
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Match: HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.065e-44
Identity = 85/130 (65.38%), Postives = 100/130 (76.92%), Query Frame = 3
Query:   36 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKA 425
            MSLIPS F GRR+NVFDPFSLDVWDP   F  S  + + S  RE   F + R+DWKETP+AHVFKADLPGL+           R+LQISGERS E+E+KND+WHRVERSSGKFLRRFRLP+NAK+++VKA
Sbjct:    1 MSLIPSFFSGRRSNVFDPFSLDVWDPLKDFPFSNSSPSASFPRENPAFVSTRVDWKETPEAHVFKADLPGLKKEEVKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKA 130          
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Match: HSP11_HELAN (17.6 kDa class I heat shock protein OS=Helianthus annuus GN=HSP17.6 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 8.917e-44
Identity = 82/130 (63.08%), Postives = 100/130 (76.92%), Query Frame = 3
Query:   36 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKA 425
            MS+IPS F  +R+N+FDPFSLD WDPF G +S+        ARET+   NARIDWKETP+AHV KADLPG++          GR+LQISGER +EQEEK+D WHRVERSSGKF+RRFRLP+NAK+++VKA
Sbjct:    1 MSIIPSFFTSKRSNIFDPFSLDTWDPFQGIIST------EPARETAAIVNARIDWKETPEAHVLKADLPGMKKEEVKVEVEDGRVLQISGERCREQEEKDDTWHRVERSSGKFIRRFRLPENAKMDEVKA 124          
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Match: HSP12_DAUCA (18.0 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.521e-43
Identity = 83/131 (63.36%), Postives = 102/131 (77.86%), Query Frame = 3
Query:   36 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGF-LSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKA 425
            MS+IPS FG RR+NV +PFSLD+WDPF  + L ++   +    +ET+ FAN  IDWKETPQAHVFKADLPGL+          G++LQISGER+KE+EEKN+KWHRVE SSGKFLRRFRLP+NA V++VKA
Sbjct:    1 MSIIPSFFGSRRSNVLNPFSLDIWDPFQDYPLITSSGTSSEFGKETAAFANTHIDWKETPQAHVFKADLPGLKKEEVKVEVEEGKVLQISGERNKEKEEKNNKWHRVEFSSGKFLRRFRLPENANVDEVKA 131          
The following BLAST results are available for this feature:
BLAST of BQ623597 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
HSP17_ARATH2.862e-5070.7717.4 kDa class I heat shock protein OS=Arabidopsis... [more]
HS181_ARATH1.420e-4971.9718.1 kDa class I heat shock protein OS=Arabidopsis... [more]
HS17C_ARATH4.133e-4972.5217.6 kDa class I heat shock protein 3 OS=Arabidops... [more]
HSP11_DAUCA1.329e-4769.2317.8 kDa class I heat shock protein OS=Daucus caro... [more]
HSP12_MEDSA2.772e-4565.3818.2 kDa class I heat shock protein OS=Medicago sa... [more]
HSP16_SOYBN3.620e-4565.9318.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP13_SOYBN3.065e-4466.4117.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP11_PEA3.065e-4465.3818.1 kDa class I heat shock protein OS=Pisum sativ... [more]
HSP11_HELAN8.917e-4463.0817.6 kDa class I heat shock protein OS=Helianthus ... [more]
HSP12_DAUCA1.521e-4363.3618.0 kDa class I heat shock protein OS=Daucus caro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00688 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00688 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623597 ID=BQ623597|Name=BQ623597|organism=Citrus sinensis|type=EST|length=426bp
TGTTGAGCATTTAATTAGCGCCCCAGTTTGCCATAATGTCACTCATTCCA
AGCATCTTCGGTGGCCGAAGAACCAACGTGTTCGATCCATTTTCATTAGA
TGTATGGGATCCTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGCGC
CGTCTTCGGCTAGGGAAACATCCCAATTCGCCAATGCAAGAATTGACTGG
AAAGAGACTCCTCAGGCTCATGTATTCAAGGCTGATCTTCCAGGGCTGAG
GAAAGAAGAAGTGAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCAGATAA
GCGGGGAGAGGAGCAAGGAGCAGGAAGAGAAGAATGACAAGTGGCATCGC
GTCGAGAGGAGCAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGACAA
TGCTAAGGTGGAGCAGGTTAAGGCCA
back to top