BQ623598

Overview
NameBQ623598
Unique NameBQ623598
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length636
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10924 contig Csv1_Contig10924:235..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Match: RH8_ARATH (DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.724e-94
Identity = 147/156 (94.23%), Postives = 153/156 (98.08%), Query Frame = 2
Query:   71 LKKGRKSTCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR 538
            +++ +K  CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKN+ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYC+
Sbjct:  350 VEERQKIHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ 505          

HSP 2 Score: 60.8474 bits (146), Expect = 1.724e-94
Identity = 27/29 (93.10%), Postives = 29/29 (100.00%), Query Frame = 1
Query:    7 PYVINLMDELTLKGITQYYAFVEERQKVH 93
            PYVINLMDELTLKGITQ+YAFVEERQK+H
Sbjct:  329 PYVINLMDELTLKGITQFYAFVEERQKIH 357          
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Match: RH8_ORYSJ (DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2)

HSP 1 Score: 298.516 bits (763), Expect = 7.131e-93
Identity = 144/156 (92.31%), Postives = 150/156 (96.15%), Query Frame = 2
Query:   71 LKKGRKSTCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR 538
            +++ +K  CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPK +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIK IPP IDQAIYC+
Sbjct:  353 VEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKTAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYCQ 508          

HSP 2 Score: 63.1586 bits (152), Expect = 7.131e-93
Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1
Query:    4 KPYVINLMDELTLKGITQYYAFVEERQKVH 93
            KPYVINLMDELTLKGITQ+YAFVEERQKVH
Sbjct:  331 KPYVINLMDELTLKGITQFYAFVEERQKVH 360          
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Match: RH6_ORYSJ (DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 1.583e-92
Identity = 143/156 (91.67%), Postives = 151/156 (96.79%), Query Frame = 2
Query:   71 LKKGRKSTCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR 538
            +++ +K  CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPK++ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIK IPP ID+AIYC+
Sbjct:  343 VEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKSAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRAIYCQ 498          

HSP 2 Score: 63.1586 bits (152), Expect = 1.583e-92
Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1
Query:    4 KPYVINLMDELTLKGITQYYAFVEERQKVH 93
            KPYVINLMDELTLKGITQ+YAFVEERQKVH
Sbjct:  321 KPYVINLMDELTLKGITQFYAFVEERQKVH 350          
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Match: RH12_ORYSJ (DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2)

HSP 1 Score: 296.59 bits (758), Expect = 2.065e-92
Identity = 143/156 (91.67%), Postives = 149/156 (95.51%), Query Frame = 2
Query:   71 LKKGRKSTCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR 538
            +++ +K  CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPK SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIK IPP ID A+YC+
Sbjct:  366 VEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKTSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAVYCQ 521          

HSP 2 Score: 63.5438 bits (153), Expect = 2.065e-92
Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1
Query:    4 KPYVINLMDELTLKGITQYYAFVEERQKVH 93
            +PYVINLMDELTLKGITQYYAFVEERQKVH
Sbjct:  344 RPYVINLMDELTLKGITQYYAFVEERQKVH 373          
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Match: RH12_ARATH (DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 3.859e-88
Identity = 135/156 (86.54%), Postives = 148/156 (94.87%), Query Frame = 2
Query:   71 LKKGRKSTCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR 538
            +++ +K  CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKM+QDHRNRVFH+FRNGACRNLVCTDLFTRGIDIQAVNVVINFDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIK IP +IDQAIYC+
Sbjct:  343 VEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMVQDHRNRVFHEFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ 498          

HSP 2 Score: 61.2326 bits (147), Expect = 3.859e-88
Identity = 27/31 (87.10%), Postives = 30/31 (96.77%), Query Frame = 1
Query:    1 QKPYVINLMDELTLKGITQYYAFVEERQKVH 93
            +KPYVINLMD+LTL G+TQYYAFVEERQKVH
Sbjct:  320 RKPYVINLMDQLTLMGVTQYYAFVEERQKVH 350          
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Match: RH6_ARATH (DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2)

HSP 1 Score: 283.108 bits (723), Expect = 1.457e-87
Identity = 135/156 (86.54%), Postives = 147/156 (94.23%), Query Frame = 2
Query:   71 LKKGRKSTCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR 538
            +++ +K  CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKM+QDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFP+ SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIK IP  ID+AIYC+
Sbjct:  373 VEERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMVQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ 528          

HSP 2 Score: 60.8474 bits (146), Expect = 1.457e-87
Identity = 26/31 (83.87%), Postives = 30/31 (96.77%), Query Frame = 1
Query:    1 QKPYVINLMDELTLKGITQYYAFVEERQKVH 93
            +KPY+INLMD+LTL G+TQYYAFVEERQKVH
Sbjct:  350 KKPYIINLMDQLTLMGVTQYYAFVEERQKVH 380          
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Match: DDX6_DICDI (Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 2.086e-83
Identity = 131/154 (85.06%), Postives = 146/154 (94.81%), Query Frame = 2
Query:   71 LKKGRKSTCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIY 532
            +++ +K  CLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCF+IHAKM+Q HRNRVFHDFRNGACRNLV +DLFTRGIDIQ VNVVINFDFPK+SETYLHR+GRSGRFGHLGLA+NLITYEDRF+LY+IEQELGTEIK IPP ID+++Y
Sbjct:  268 VEERQKIHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFFIHAKMVQAHRNRVFHDFRNGACRNLVSSDLFTRGIDIQDVNVVINFDFPKHSETYLHRIGRSGRFGHLGLAINLITYEDRFSLYKIEQELGTEIKPIPPVIDKSLY 421          

HSP 2 Score: 55.8398 bits (133), Expect = 2.086e-83
Identity = 24/31 (77.42%), Postives = 29/31 (93.55%), Query Frame = 1
Query:    1 QKPYVINLMDELTLKGITQYYAFVEERQKVH 93
            Q+ + INLM+ELTLKG+TQYYAFVEERQK+H
Sbjct:  245 QQAFEINLMEELTLKGVTQYYAFVEERQKIH 275          
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Match: DDX6_MOUSE (Probable ATP-dependent RNA helicase DDX6 OS=Mus musculus GN=Ddx6 PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 7.206e-81
Identity = 124/150 (82.67%), Postives = 139/150 (92.67%), Query Frame = 2
Query:   83 RKSTCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIY 532
            +K  CLNTLFS+LQINQSIIFCNS  RVELLAKKI++LGYSCFYIHAKM Q+HRNRVFHDFRNG CRNLVCTDLFTRGIDIQAVNVVINFDFPK +ETYLHR+GRSGRFGHLGLA+NLITY+DRFNL  IE++LGTEIK IP +ID+++Y
Sbjct:  320 QKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLY 469          

HSP 2 Score: 58.9214 bits (141), Expect = 7.206e-81
Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1
Query:    1 QKPYVINLMDELTLKGITQYYAFVEERQKVH 93
            QKPY INLM+ELTLKG+TQYYA+V ERQKVH
Sbjct:  293 QKPYEINLMEELTLKGVTQYYAYVTERQKVH 323          
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Match: DDX6_HUMAN (Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens GN=DDX6 PE=1 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 7.206e-81
Identity = 124/150 (82.67%), Postives = 139/150 (92.67%), Query Frame = 2
Query:   83 RKSTCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIY 532
            +K  CLNTLFS+LQINQSIIFCNS  RVELLAKKI++LGYSCFYIHAKM Q+HRNRVFHDFRNG CRNLVCTDLFTRGIDIQAVNVVINFDFPK +ETYLHR+GRSGRFGHLGLA+NLITY+DRFNL  IE++LGTEIK IP +ID+++Y
Sbjct:  320 QKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLY 469          

HSP 2 Score: 58.9214 bits (141), Expect = 7.206e-81
Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1
Query:    1 QKPYVINLMDELTLKGITQYYAFVEERQKVH 93
            QKPY INLM+ELTLKG+TQYYA+V ERQKVH
Sbjct:  293 QKPYEINLMEELTLKGVTQYYAYVTERQKVH 323          
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Match: DDX6_CHICK (Probable ATP-dependent RNA helicase DDX6 OS=Gallus gallus GN=DDX6 PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 7.206e-81
Identity = 124/150 (82.67%), Postives = 139/150 (92.67%), Query Frame = 2
Query:   83 RKSTCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKMLQDHRNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNSETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIY 532
            +K  CLNTLFS+LQINQSIIFCNS  RVELLAKKI++LGYSCFYIHAKM Q+HRNRVFHDFRNG CRNLVCTDLFTRGIDIQAVNVVINFDFPK +ETYLHR+GRSGRFGHLGLA+NLITY+DRFNL  IE++LGTEIK IP +ID+++Y
Sbjct:  320 QKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLY 469          

HSP 2 Score: 58.9214 bits (141), Expect = 7.206e-81
Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1
Query:    1 QKPYVINLMDELTLKGITQYYAFVEERQKVH 93
            QKPY INLM+ELTLKG+TQYYA+V ERQKVH
Sbjct:  293 QKPYEINLMEELTLKGVTQYYAYVTERQKVH 323          
The following BLAST results are available for this feature:
BLAST of BQ623598 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RH8_ARATH1.724e-9494.23DEAD-box ATP-dependent RNA helicase 8 OS=Arabidops... [more]
RH8_ORYSJ7.131e-9392.31DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sat... [more]
RH6_ORYSJ1.583e-9291.67DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sat... [more]
RH12_ORYSJ2.065e-9291.67DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sa... [more]
RH12_ARATH3.859e-8886.54DEAD-box ATP-dependent RNA helicase 12 OS=Arabidop... [more]
RH6_ARATH1.457e-8786.54DEAD-box ATP-dependent RNA helicase 6 OS=Arabidops... [more]
DDX6_DICDI2.086e-8385.06Probable ATP-dependent RNA helicase ddx6 OS=Dictyo... [more]
DDX6_MOUSE7.206e-8182.67Probable ATP-dependent RNA helicase DDX6 OS=Mus mu... [more]
DDX6_HUMAN7.206e-8182.67Probable ATP-dependent RNA helicase DDX6 OS=Homo s... [more]
DDX6_CHICK7.206e-8182.67Probable ATP-dependent RNA helicase DDX6 OS=Gallus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00689 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00689 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623598 ID=BQ623598|Name=BQ623598|organism=Citrus sinensis|type=EST|length=636bp
CAAAAACCATATGTTATTAATCTGATGGATGAGCTTACTCTCAAGGGAAT
TACCCAATACTATGCTTTTGTTGAAGAAAGGCAGAAAGTCCACTTGCCTC
AACACACTTTTCTCTAAGTTGCAAATTAATCAATCTATCATTTTCTGCAA
TTCGGTGAATCGGGTTGAACTCCTTGCCAAGAAAATTACAGAACTTGGGT
ACTCTTGTTTTTATATCCATGCAAAGATGCTGCAAGACCATCGCAACAGA
GTATTTCATGACTTCCGCAATGGTGCATGCAGGAATCTTGTTTGTACTGA
CCTATTTACGAGGGGTATAGACATTCAAGCAGTGAATGTTGTCATTAACT
TTGATTTTCCTAAGAACTCGGAGACATATCTGCACAGAGTTGGTCGATCT
GGAAGGTTTGGACACCTTGGATTAGCTGTGAATTTGATTACTTACGAGGA
CCGCTTCAACTTGTATAGGATTGAGCAAGAACTCGGGACTGAAATTAAGC
AGATACCTCCGCATATTGATCAGGCAATTTACTGCAGGTGATTTATGGCC
GGTATCTTGCTATATAGCCAATGGTGGTAGCAATGGATTCCTGAGGCTGT
TGATTCAAGGCACTTGGCTCTGCAGCTGAGGAAGCA
back to top