BQ623605

Overview
NameBQ623605
Unique NameBQ623605
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length519
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7943 contig Csv1_Contig7943:622..1138. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623605 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.371e-27
Identity = 44/73 (60.27%), Postives = 55/73 (75.34%), Query Frame = 1
Query:  133 KQPMNAYTRILAKKYPNFCINCVCPGYVKTEMTYNAGRLTVEEGAESPVWLALL-HKGGPSGLFFSRKEETLF 348
            K  +N YTR+LAKK+P F +N VCPG+VKT+M +  G L+VEEGA SPV LALL H+  PSG FFSRK+ + F
Sbjct:  224 KASLNGYTRVLAKKHPEFRVNAVCPGFVKTDMNFKTGVLSVEEGASSPVRLALLPHQETPSGCFFSRKQVSEF 296          

HSP 2 Score: 52.373 bits (124), Expect = 1.371e-27
Identity = 24/46 (52.17%), Postives = 33/46 (71.74%), Query Frame = 2
Query:    5 SDAENLTEERVDEVLSQYLNDYKEGSPETKGWPANAACLHTIKSSL 142
            SDAENLTEER+D+V++Q LND+KEG+ + K W    +     K+SL
Sbjct:  182 SDAENLTEERIDQVINQLLNDFKEGTVKEKNWAKFMSAYVVSKASL 227          
BLAST of BQ623605 vs. ExPASy Swiss-Prot
Match: SDR2_ARATH (Short-chain dehydrogenase/reductase 2 OS=Arabidopsis thaliana GN=SDR2 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.530e-25
Identity = 44/73 (60.27%), Postives = 54/73 (73.97%), Query Frame = 1
Query:  133 KQPMNAYTRILAKKYPNFCINCVCPGYVKTEMTYNAGRLTVEEGAESPVWLALL-HKGGPSGLFFSRKEETLF 348
            K  +NAYTRILAKK+P   +N VCPG+VKT+M +  G L+VEEGA SPV LALL H+  PSG FF RK+ + F
Sbjct:  224 KAGLNAYTRILAKKHPEIRVNSVCPGFVKTDMNFKTGILSVEEGASSPVRLALLPHQESPSGCFFDRKQVSEF 296          

HSP 2 Score: 45.8246 bits (107), Expect = 4.530e-25
Identity = 20/32 (62.50%), Postives = 26/32 (81.25%), Query Frame = 2
Query:    5 SDAENLTEERVDEVLSQYLNDYKEGSPETKGW 100
            SDAENLTE R+D+V++Q LND KE + +TK W
Sbjct:  182 SDAENLTEVRIDQVINQLLNDLKEDTAKTKYW 213          
BLAST of BQ623605 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum GN=SALR PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.984e-23
Identity = 39/72 (54.17%), Postives = 47/72 (65.28%), Query Frame = 1
Query:  133 KQPMNAYTRILAKKYPNFCINCVCPGYVKTEMTYNAGRLTVEEGAESPVWLALLHKGGPSGLFFSRKEETLF 348
            K  +NAYTR+LAKK P F +NCVCPG VKTEM Y  G  T +EGA+  V +AL    GPSG F+   E + F
Sbjct:  240 KACLNAYTRVLAKKIPKFQVNCVCPGLVKTEMNYGIGNYTADEGAKHVVRIALFPDDGPSGFFYDCSELSAF 311          

HSP 2 Score: 45.0542 bits (105), Expect = 3.984e-23
Identity = 21/45 (46.67%), Postives = 28/45 (62.22%), Query Frame = 2
Query:    8 DAENLTEERVDEVLSQYLNDYKEGSPETKGWPANAACLHTIKSSL 142
            D + LTEER+D V++  L D+KE   ET GWP+  A   T K+ L
Sbjct:  199 DGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACL 243          
BLAST of BQ623605 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum GN=MNR1 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.736e-18
Identity = 50/81 (61.73%), Postives = 55/81 (67.90%), Query Frame = 1
Query:  112 SMLTYYQ--KQPMNAYTRILAKKYPNFCINCVCPGYVKTEMTYNAGRLTVEEGAESPVWLALLHKGGPSGLFFSRKEETLF 348
            S  T Y+  K  + AYTR+LA KYPNF IN VCPGY KT++  N G LT  EGAES V LALL   GPSGLFF RKE T F
Sbjct:  234 SYFTAYKVSKASLIAYTRVLATKYPNFRINSVCPGYCKTDVNANTGSLTAGEGAESLVNLALLPNDGPSGLFFYRKEVTFF 314          
The following BLAST results are available for this feature:
BLAST of BQ623605 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
SDR1_ARATH1.371e-2760.27(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2_ARATH4.530e-2560.27Short-chain dehydrogenase/reductase 2 OS=Arabidops... [more]
SALR_PAPBR3.984e-2354.17Salutaridine reductase OS=Papaver bracteatum GN=SA... [more]
MNR1_CAPAN1.736e-1861.73(+)-neomenthol dehydrogenase OS=Capsicum annuum GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00696 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00696 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623605 ID=BQ623605|Name=BQ623605|organism=Citrus sinensis|type=EST|length=519bp
GTTTAGTGATGCTGAGAACCTCACAGAAGAAAGAGTGGATGAGGTATTGA
GCCAGTATCTAAATGATTACAAAGAGGGTTCACCGGAAACTAAAGGATGG
CCTGCTAATGCAGCATGCTTACATACTATCAAAAGCAGCCTATGAATGCC
TACACAAGGATCCTGGCCAAGAAGTACCCAAATTTTTGCATCAATTGCGT
TTGCCCTGGCTATGTTAAAACAGAAATGACCTACAACGCTGGTAGATTAA
CTGTAGAAGAAGGTGCCGAATCTCCAGTTTGGTTGGCTCTGCTGCACAAG
GGCGGTCCTTCTGGTCTATTCTTTTCACGGAAAGAAGAGACCCTTTTTTG
ATTGAAAATGATTCATCGATCACTGCATACCGATGTTGAATTTACATATC
TTTTGATGTTGAATTTGAATAAGTGAAATATCATCTTATGCAATTGAACC
CTTTGTTAAAAGTAATAGATGAATGGACTCATCCAAATACTTGAGTGCAA
AAAAAAAAAAAAAAAAAAC
back to top