BQ623608

Overview
NameBQ623608
Unique NameBQ623608
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length452
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1793 contig Csv1_Contig1793:198..649. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Match: GLRX_SOLLC (Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 3.158e-43
Identity = 82/106 (77.36%), Postives = 94/106 (88.68%), Query Frame = 3
Query:   39 MALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAVAKTA 356
            M+L KA+E VS N V VFSKT CPFCVSVK+L  +LG TFKA+ELD E DGS+IQ+ALAEWTGQ+TVPNVFIG KHIGGCD+TTALHREGKL+PLLTEAGA+AKT+
Sbjct:    1 MSLAKAKEIVSGNPVAVFSKTYCPFCVSVKDLLSKLGATFKAVELDSEKDGSEIQAALAEWTGQRTVPNVFIGRKHIGGCDATTALHREGKLLPLLTEAGAIAKTS 106          
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Match: GLRX_VERFO (Glutaredoxin OS=Vernicia fordii PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 9.189e-43
Identity = 81/102 (79.41%), Postives = 90/102 (88.24%), Query Frame = 3
Query:   39 MALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAV 344
            MA+ KAQE VSSNSVVVFSKT CP+C SVK+L  QLG  FK IELD ESDGSD+Q+ALAEWTGQ+TVPNVFIGGKHIGGCD TT +H+EGKL+PLLTEAGAV
Sbjct:    1 MAMIKAQELVSSNSVVVFSKTFCPYCTSVKQLLNQLGAQFKVIELDSESDGSDLQNALAEWTGQRTVPNVFIGGKHIGGCDKTTGMHQEGKLIPLLTEAGAV 102          
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Match: GRXC6_ORYSJ (Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN=GRXC6 PE=1 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 5.956e-42
Identity = 82/106 (77.36%), Postives = 94/106 (88.68%), Query Frame = 3
Query:   39 MALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAVAKTA 356
            MAL KA+ETV+S  VVV+SK+ CPFCV VK+LF+QLG TFKAIELD ESDGS++QSALAEWTGQ+TVPNVFI GKHIGGCD T AL+ EGKLVPLLTEAGA+A +A
Sbjct:    1 MALAKAKETVASAPVVVYSKSYCPFCVRVKKLFEQLGATFKAIELDGESDGSELQSALAEWTGQRTVPNVFINGKHIGGCDDTLALNNEGKLVPLLTEAGAIASSA 106          
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Match: GRXC2_ARATH (Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 2.263e-41
Identity = 82/107 (76.64%), Postives = 93/107 (86.92%), Query Frame = 3
Query:   39 MALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAVA-KTA 356
            MA+ KA+E V+S SVVVFSKT CP+CV VKEL QQLG  FKA+ELD ESDGS IQS LAEWTGQ+TVPNVFIGG HIGGCD+T+ LH++GKLVPLLTEAGA+A KTA
Sbjct:    1 MAMQKAKEIVNSESVVVFSKTYCPYCVRVKELLQQLGAKFKAVELDTESDGSQIQSGLAEWTGQRTVPNVFIGGNHIGGCDATSNLHKDGKLVPLLTEAGAIAGKTA 107          
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Match: GLRX_RICCO (Glutaredoxin OS=Ricinus communis PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 3.268e-40
Identity = 77/102 (75.49%), Postives = 89/102 (87.25%), Query Frame = 3
Query:   39 MALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAV 344
            MA+ K +E VSSN+VVVFSKT CP+C SVK+L  QLG  +K +ELD ESDGS+IQ+ALAEWTGQ+TVPNVFIGGKHIGGCDSTTA H +G+LVPLLTEAGAV
Sbjct:    1 MAMTKTKELVSSNAVVVFSKTYCPYCTSVKKLLDQLGAKYKVVELDTESDGSEIQTALAEWTGQRTVPNVFIGGKHIGGCDSTTAKHSQGQLVPLLTEAGAV 102          
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Match: GRXC4_ORYSJ (Glutaredoxin-C4, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXC4 PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 3.739e-36
Identity = 71/112 (63.39%), Postives = 89/112 (79.46%), Query Frame = 3
Query:   12 RIKDKEDTEMALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAVA 347
            ++++     MAL KA+E V+S+ VVVFSKT CPFC  VK L  +L  ++KA+ELD ESDGS++QSALA+WTGQ+TVP VFI GKHIGGCD T A+H+ G LVPLLTEAGA+A
Sbjct:   18 QLEEPSKPVMALDKAKEIVASSPVVVFSKTYCPFCARVKRLLAELAASYKAVELDVESDGSELQSALADWTGQRTVPCVFIKGKHIGGCDDTMAMHKGGNLVPLLTEAGAIA 129          
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Match: GRXC1_ARATH (Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 3.500e-34
Identity = 69/112 (61.61%), Postives = 86/112 (76.79%), Query Frame = 3
Query:   24 KEDTEMALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAVAKTAA 359
            KE+ E+ + KA+E VS+  VVVFSKT C +C  VK+L  QLG TFK +ELD+ SDG +IQSAL+EWTGQ TVPNVFI G HIGGCD     +++GKLVPLLTEAGA+A  ++
Sbjct:   12 KEEMEVVVNKAKEIVSAYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEMSDGGEIQSALSEWTGQTTVPNVFIKGNHIGGCDRVMETNKQGKLVPLLTEAGAIADNSS 123          
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Match: GLRX_DICDI (Glutaredoxin OS=Dictyostelium discoideum GN=grxA PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 7.815e-26
Identity = 52/98 (53.06%), Postives = 74/98 (75.51%), Query Frame = 3
Query:   45 LPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAG 338
            + K +  + ++ +++FSKT CP+C+SVK+LF++L V    +ELD ESDGS++QSA  + +G +TVP VFI  K IGGCD+TT LH +GKL+PLL EAG
Sbjct:    1 MDKVKALIKAHKLIIFSKTTCPYCISVKDLFKKLKVVPFVVELDLESDGSELQSAAGQISGVRTVPQVFINEKFIGGCDATTKLHSQGKLIPLLQEAG 98          
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Match: GLRX2_MOUSE (Glutaredoxin-2, mitochondrial OS=Mus musculus GN=Glrx2 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.602e-21
Identity = 45/100 (45.00%), Postives = 67/100 (67.00%), Query Frame = 3
Query:   27 EDTEMALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLL 326
            + T   + + QET+S+N VV+FSKT C +C   K++F  + V +KA+ELD    G+  Q AL + TG++TVP +F+ G+ IGG   T  LH+EGKL+PL+
Sbjct:   44 KSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERTVPRIFVNGRFIGGAADTHRLHKEGKLLPLV 143          
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Match: GLRX2_BOVIN (Glutaredoxin-2, mitochondrial OS=Bos taurus GN=GLRX2 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 4.438e-21
Identity = 45/90 (50.00%), Postives = 60/90 (66.67%), Query Frame = 3
Query:   57 QETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLL 326
            QET+S+N VV+FSKT C +C   K LF  + V +K +ELD    GS  Q AL + TG++TVP +F+ G  IGG   T  LH+EGKL+PL+
Sbjct:   55 QETISNNCVVIFSKTSCSYCTMAKNLFHDMNVNYKVVELDMLEYGSQFQDALHKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLV 144          
The following BLAST results are available for this feature:
BLAST of BQ623608 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
GLRX_SOLLC3.158e-4377.36Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1[more]
GLRX_VERFO9.189e-4379.41Glutaredoxin OS=Vernicia fordii PE=3 SV=1[more]
GRXC6_ORYSJ5.956e-4277.36Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN... [more]
GRXC2_ARATH2.263e-4176.64Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 P... [more]
GLRX_RICCO3.268e-4075.49Glutaredoxin OS=Ricinus communis PE=3 SV=1[more]
GRXC4_ORYSJ3.739e-3663.39Glutaredoxin-C4, chloroplastic OS=Oryza sativa sub... [more]
GRXC1_ARATH3.500e-3461.61Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 P... [more]
GLRX_DICDI7.815e-2653.06Glutaredoxin OS=Dictyostelium discoideum GN=grxA P... [more]
GLRX2_MOUSE2.602e-2145.00Glutaredoxin-2, mitochondrial OS=Mus musculus GN=G... [more]
GLRX2_BOVIN4.438e-2150.00Glutaredoxin-2, mitochondrial OS=Bos taurus GN=GLR... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00699 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00699 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623608 ID=BQ623608|Name=BQ623608|organism=Citrus sinensis|type=EST|length=452bp
TTGTGAGATTTCGAATCAAAGACAAAGAAGACACAGAAATGGCTTTGCCC
AAGGCCCAGGAAACCGTTTCCTCCAATTCCGTCGTCGTTTTCAGCAAAAC
GCTTTGTCCGTTCTGCGTGAGTGTCAAAGAGCTGTTTCAGCAACTCGGAG
TCACTTTCAAGGCCATTGAACTGGACAAAGAAAGTGATGGAAGTGACATT
CAATCAGCTCTAGCTGAGTGGACTGGACAGAAAACTGTTCCAAATGTCTT
CATCGGAGGGAAACACATTGGTGGCTGCGATTCAACTACTGCACTGCACA
GGGAAGGGAAGCTGGTTCCTCTGCTCACTGAAGCTGGAGCTGTTGCCAAG
ACAGCTGCCTAAGGGATGGCTATTCTCTGCCTGTTTATGCTAGTAATAAA
TAAACAATGTGTTGGTAGTGCTTAATCTGTCTGAATTAAATATGAAATTA
TG
back to top