BQ623609

Overview
NameBQ623609
Unique NameBQ623609
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length551
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1212 contig Csv1_Contig1212:73..624. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623609 vs. ExPASy Swiss-Prot
Match: 21KD_DAUCA (21 kDa protein OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 2.314e-43
Identity = 83/146 (56.85%), Postives = 111/146 (76.03%), Query Frame = 1
Query:   70 AAGIADTRFIRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFVTKLRKFRNLKHREYGAIADCLDEMGDTVDRLSKSVQELNHMGRAKGQDFLWHMSNVETWVSAALTDENTCTDGFGGKALEGKGKSS 507
            A+     +FI++SC  TTYPA+C QSLSAYA +IQ +P++LA TAL VSL+R Q A++F+ +L KF+ LK R+Y AI DCL+E+ D++DR+S+S  E+ ++  AKG DF + MSNVETWVSAALTDE TC DGF GK ++GK K S
Sbjct:   20 ASAAPANQFIKTSCTLTTYPAVCEQSLSAYAKTIQNNPQELASTALQVSLTRTQQAQTFMKRLNKFKGLKARQYAAIHDCLEEVEDSLDRVSRSCDEMKNLSHAKGNDFTFRMSNVETWVSAALTDETTCMDGFAGKGMDGKIKES 165          
BLAST of BQ623609 vs. ExPASy Swiss-Prot
Match: PME3_CITSI (Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 8.576e-14
Identity = 42/127 (33.07%), Postives = 73/127 (57.48%), Query Frame = 1
Query:   97 IRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSF--VTKLRKFRNLKHREYGAIADCLDEMGDTVDRLSKSVQELNHMGRAKGQDFLWHMSNVETWVSAALTDENTCTDGF 471
            ++SSC ST YP LC  +++A   + ++   Q  V  +S++++      ++  + KL K  NL  RE  A+ DCL+ + +T+D L K+V++L      K      H  +++T +SAA+T++ TC DGF
Sbjct:   69 LKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVEHNYFGIQKLLKRTNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKK--SLSQHADDLKTLMSAAMTNQGTCLDGF 193          
BLAST of BQ623609 vs. ExPASy Swiss-Prot
Match: PME1_CITSI (Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 8.576e-14
Identity = 42/127 (33.07%), Postives = 73/127 (57.48%), Query Frame = 1
Query:   97 IRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSF--VTKLRKFRNLKHREYGAIADCLDEMGDTVDRLSKSVQELNHMGRAKGQDFLWHMSNVETWVSAALTDENTCTDGF 471
            ++SSC ST YP LC  +++A   + ++   Q  V  +S++++      ++  + KL K  NL  RE  A+ DCL+ + +T+D L K+V++L      K      H  +++T +SAA+T++ TC DGF
Sbjct:   69 LKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVEHNYFGIQKLLKRTNLTKREKVALHDCLETIDETLDELHKAVEDLEEYPNKK--SLSQHADDLKTLMSAAMTNQGTCLDGF 193          
BLAST of BQ623609 vs. ExPASy Swiss-Prot
Match: PME3_PHAVU (Pectinesterase 3 OS=Phaseolus vulgaris GN=MPE3 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.706e-12
Identity = 46/127 (36.22%), Postives = 65/127 (51.18%), Query Frame = 1
Query:   97 IRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFVTKLRKFRNLKHREYGAIADCLDEMGDTVDRLSKSVQELNHM-GRAKGQDFLWHMSNVETWVSAALTDENTCTDGFG 474
            +++ C +T YP+ C  S+S+   S    P  L   +L V++    S   F +KLR       R   AI  C    GD +DRL+ S+  L  + GR         +SNVETW+SAALTD++TC D  G
Sbjct:   77 LKAVCDTTRYPSSCFSSISSLPESNTTDPELLFKLSLRVAIDELSS---FPSKLRANAEQDARLQKAIDVCSSVFGDALDRLNDSISALGTVAGRIASSA---SVSNVETWLSAALTDQDTCLDAVG 197          
BLAST of BQ623609 vs. ExPASy Swiss-Prot
Match: PME3_ARATH (Pectinesterase/pectinesterase inhibitor 3 OS=Arabidopsis thaliana GN=PME3 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 1.788e-11
Identity = 39/126 (30.95%), Postives = 74/126 (58.73%), Query Frame = 1
Query:   97 IRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFVTKL-RKFRNLKHREYGAIADCLDEMGDTVDRLSKSVQELNHMGRAKGQDFLWHMSNVETWVSAALTDENTCTDGF 471
            +RSSC ST YP LC+ ++         S + +   +++++++  +     V KL +K + L  RE  A+ DCL+ + +T+D L ++V++L H+   K +    H  +++T +S+A+T++ TC DGF
Sbjct:   59 LRSSCSSTRYPELCISAVVTAGGVELTSQKDVIEASVNLTITAVEHNYFTVKKLIKKRKGLTPREKTALHDCLETIDETLDELHETVEDL-HLYPTK-KTLREHAGDLKTLISSAITNQETCLDGF 182          
BLAST of BQ623609 vs. ExPASy Swiss-Prot
Match: PME2_ARATH (Pectinesterase 2 OS=Arabidopsis thaliana GN=PME2 PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 3.050e-11
Identity = 39/137 (28.47%), Postives = 72/137 (52.55%), Query Frame = 1
Query:   64 VTAAGIADTRFIRSSCKSTTYPALCVQSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFVTKL-RKFRNLKHREYGAIADCLDEMGDTVDRLSKSVQELNHMGRAKGQDFLWHMSNVETWVSAALTDENTCTDGF 471
            +T         ++S C ST YP LC  +++A       S +++   +L+++    +     V KL  K + L  RE  A+ DCL+ + +T+D L  +V++L+   + K      H  +++T +S+A+T++ TC DGF
Sbjct:   51 ITTLSSTSHAILKSVCSSTLYPELCFSAVAATGGKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTPREVTALHDCLETIDETLDELHVAVEDLHQYPKQK--SLRKHADDLKTLISSAITNQGTCLDGF 185          
The following BLAST results are available for this feature:
BLAST of BQ623609 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
21KD_DAUCA2.314e-4356.8521 kDa protein OS=Daucus carota PE=2 SV=1[more]
PME3_CITSI8.576e-1433.07Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1[more]
PME1_CITSI8.576e-1433.07Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE... [more]
PME3_PHAVU4.706e-1236.22Pectinesterase 3 OS=Phaseolus vulgaris GN=MPE3 PE=... [more]
PME3_ARATH1.788e-1130.95Pectinesterase/pectinesterase inhibitor 3 OS=Arabi... [more]
PME2_ARATH3.050e-1128.47Pectinesterase 2 OS=Arabidopsis thaliana GN=PME2 P... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00700 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00700 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623609 ID=BQ623609|Name=BQ623609|organism=Citrus sinensis|type=EST|length=551bp
GAAAACATGGCAAAAACAGGCTGTCTTTTGCTATTGCTCTCTCTCCTCTA
CATTATAAGCTTGGTCACAGCTGCCGGGATTGCTGACACAAGATTTATCA
GAAGTTCTTGCAAATCCACAACTTATCCAGCGCTATGCGTGCAGTCTCTC
TCAGCTTATGCCCCATCAATTCAACAAAGCCCCCGGCAACTGGCTGTCAC
AGCCTTGTCCGTGAGCCTCTCCAGGGCCCAATCCGCAAAGTCATTCGTGA
CCAAGCTGAGGAAGTTCAGGAACCTGAAGCACAGAGAGTATGGGGCAATT
GCCGACTGCTTAGATGAGATGGGTGACACTGTGGACCGGCTCAGCAAGTC
GGTTCAGGAGCTGAACCACATGGGTCGGGCCAAGGGTCAGGACTTTCTGT
GGCACATGAGCAACGTTGAGACATGGGTTAGTGCTGCTTTGACTGATGAG
AACACTTGTACTGATGGGTTCGGTGGCAAGGCCTTGGAGGGTAAGGGTAA
GTCCTCTGTAGGGCTCAGGGTGTTAATGTTGCTCAGGGCACTAGCAATGC
C
back to top