BQ623610

Overview
NameBQ623610
Unique NameBQ623610
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length536
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1212 contig Csv1_Contig1212:77..609. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623610 vs. ExPASy Swiss-Prot
Match: 21KD_DAUCA (21 kDa protein OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 4.579e-41
Identity = 83/153 (54.25%), Postives = 112/153 (73.20%), Query Frame = 3
Query:   66 AAGIADTRFIRSSCKSTTISSAGA*QSLSAYAPSIQQSPRQLAVTALSVSLSRAQSAKSFVTKLRKFRNLKHREYEAIADCLDEMGDTVDRLSKSVQELNHMGQAKGQDFLWHMSNVETWVSAALTDENTCTDGFGGKALEGKVKNSVRAHAV 524
            A+     +FI++SC  TT  +    QSLSAYA +IQ +P++LA TAL VSL+R Q A++F+ +L KF+ LK R+Y AI DCL+E+ D++DR+S+S  E+ ++  AKG DF + MSNVETWVSAALTDE TC DGF GK ++GK+K SVRA  V
Sbjct:   20 ASAAPANQFIKTSCTLTTYPAVCE-QSLSAYAKTIQNNPQELASTALQVSLTRTQQAQTFMKRLNKFKGLKARQYAAIHDCLEEVEDSLDRVSRSCDEMKNLSHAKGNDFTFRMSNVETWVSAALTDETTCMDGFAGKGMDGKIKESVRAQVV 171          
The following BLAST results are available for this feature:
BLAST of BQ623610 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
21KD_DAUCA4.579e-4154.2521 kDa protein OS=Daucus carota PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00701 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00701 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623610 ID=BQ623610|Name=BQ623610|organism=Citrus sinensis|type=EST|length=536bp
ACATGGCAAAAACAGGCTGTCTTTTGCTATTGCTCTCTCTCCTCTACATT
ATAAGCTTGGTCACAGCTGCCGGGATTGCTGACACAAGATTTATCAGAAG
TTCTTGCAAATCCACAACTATATCCAGCGCTGGTGCGTAGCAGTCTCTCT
CAGCTTATGCCCCATCAATTCAACAAAGCCCCCGGCAACTGGCTGTCACA
GCCTTGTCCGTGAGCCTCTCCAGGGCCCAATCCGCAAAGTCATTCGTGAC
CAAGCTGAGGAAGTTCAGGAACCTGAAGCACAGAGAGTATGAGGCGATTG
CCGACTGCTTGGATGAGATGGGTGACACTGTGGACCGGCTCAGCAAGTCG
GTTCAGGAGCTGAACCACATGGGTCAGGCCAAGGGTCAGGACTTTCTGTG
GCACATGAGCAACGTTGAGACATGGGTTAGTGCTGCTTTGACTGATGAGA
ACACTTGTACTGATGGGTTCGGTGGCAAGGCCTTGGAGGGTAAGGTTAAA
AACTCTGTCAGGGCTCATGCCGTCTATGCAGTTGAT
back to top