BQ623852
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of BQ623852 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 7.087e-16 Identity = 35/55 (63.64%), Postives = 44/55 (80.00%), Query Frame = 3 Query: 66 DRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 230 D++QCVKKGSSY AD +ET+ S ++ VVMD AAE +G CKCGP+C+C NCTCG Sbjct: 12 DKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64
BLAST of BQ623852 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 3.292e-13 Identity = 32/56 (57.14%), Postives = 41/56 (73.21%), Query Frame = 3 Query: 66 DRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCGS 233 D+SQCVKKG+SY D VET+ S+V V+V +AAE +G CKCG CAC +C CG+ Sbjct: 11 DKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65
BLAST of BQ623852 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.383e-11 Identity = 34/54 (62.96%), Postives = 39/54 (72.22%), Query Frame = 3 Query: 66 DRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 227 D SQCVKKG+S D VETD S++ VV M V AAE+ G CKCG +C CVNCTC Sbjct: 12 DSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62
BLAST of BQ623852 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 4.024e-11 Identity = 31/54 (57.41%), Postives = 37/54 (68.52%), Query Frame = 3 Query: 66 DRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 227 D SQC KKG S+ VET+ + TV+ MD AAE GNCKCGP+CACV+C C Sbjct: 12 DSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64
BLAST of BQ623852 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 8.965e-11 Identity = 31/55 (56.36%), Postives = 38/55 (69.09%), Query Frame = 3 Query: 66 DRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 230 D +QCVKKG+SY VET+ + TV V D AAE +G CKCG C+CV+CTCG Sbjct: 12 DSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65 The following BLAST results are available for this feature:
BLAST of BQ623852 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623852 ID=BQ623852; Name=BQ623852; organism=Citrus sinensis; type=EST; length=495bpback to top |