C21906
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of C21906 vs. ExPASy Swiss-Prot
Match: BH066_ARATH (Transcription factor bHLH66 OS=Arabidopsis thaliana GN=BHLH66 PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.753e-12 Identity = 36/40 (90.00%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 10 KALQELXPNANKTDKASMLDEIIDYXKFLQLQVKVLSMXR 129 KALQEL PN NKTDKASMLDEIIDY KFLQLQVKVLSM R Sbjct: 165 KALQELVPNGNKTDKASMLDEIIDYVKFLQLQVKVLSMSR 204
BLAST of C21906 vs. ExPASy Swiss-Prot
Match: BH069_ARATH (Transcription factor bHLH69 OS=Arabidopsis thaliana GN=BHLH69 PE=2 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 3.906e-12 Identity = 35/40 (87.50%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 10 KALQELXPNANKTDKASMLDEIIDYXKFLQLQVKVLSMXR 129 K+LQEL PN NKTDKASMLDEIIDY KFLQLQVKVLSM R Sbjct: 157 KSLQELVPNGNKTDKASMLDEIIDYVKFLQLQVKVLSMSR 196
BLAST of C21906 vs. ExPASy Swiss-Prot
Match: BH082_ARATH (Transcription factor bHLH82 OS=Arabidopsis thaliana GN=BHLH82 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.532e-11 Identity = 33/40 (82.50%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 10 KALQELXPNANKTDKASMLDEIIDYXKFLQLQVKVLSMXR 129 K+LQEL PN NKTDKASMLDEII+Y +FLQLQVKVLSM R Sbjct: 126 KSLQELVPNTNKTDKASMLDEIIEYVRFLQLQVKVLSMSR 165 The following BLAST results are available for this feature:
BLAST of C21906 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >C21906 ID=C21906; Name=C21906; organism=Citrus sinensis; type=EST; length=219bpback to top |