CA588029

Overview
NameCA588029
Unique NameCA588029
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length475
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7794 contig Csv1_Contig7794:216..690. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CA588029 vs. ExPASy Swiss-Prot
Match: RRP3_SPIOL (30S ribosomal protein 3, chloroplastic OS=Spinacia oleracea GN=PSRP3 PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 6.876e-42
Identity = 79/98 (80.61%), Postives = 87/98 (88.78%), Query Frame = 1
Query:   10 VETKKAGVSVKQLEKPRLVLKFIWMEKNIGLALDQTIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMIILLNQATDIINLWQQSGGNLTT 303
            V  +K  V VK ++KPRLVLKFIWMEKNIGLALDQTIPG+GT+PLS Y+FWPRKDAWEELK  LE+KPWISQK MIILLNQATDIINLWQQSGGNL +
Sbjct:   82 VNKEKLKVLVKPMDKPRLVLKFIWMEKNIGLALDQTIPGHGTVPLSPYYFWPRKDAWEELKVLLENKPWISQKQMIILLNQATDIINLWQQSGGNLAS 179          
BLAST of CA588029 vs. ExPASy Swiss-Prot
Match: RRP31_ARATH (30S ribosomal protein 3-1, chloroplastic OS=Arabidopsis thaliana GN=At1g68590 PE=1 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 3.773e-40
Identity = 79/100 (79.00%), Postives = 87/100 (87.00%), Query Frame = 1
Query:    4 TPVETKKAGVSVKQLEKPRLVLKFIWMEKNIGLALDQTIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMIILLNQATDIINLWQQSGGNLTT 303
            TP +T K    VK  EK R+VLKF+WMEKNIGL LDQ +PG+GTIPLS YFFWPRKDAWEELK+TLE+KPWISQK MIILLNQATDIINLWQQSGGNLT+
Sbjct:   69 TPQQTIKV---VKPDEKSRVVLKFVWMEKNIGLGLDQHVPGHGTIPLSPYFFWPRKDAWEELKSTLEAKPWISQKKMIILLNQATDIINLWQQSGGNLTS 165          
BLAST of CA588029 vs. ExPASy Swiss-Prot
Match: RRP32_ARATH (30S ribosomal protein 3-2, chloroplastic OS=Arabidopsis thaliana GN=At5g15760 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 3.904e-37
Identity = 70/98 (71.43%), Postives = 83/98 (84.69%), Query Frame = 1
Query:    7 PVETKKAGVSVKQLEKPRLVLKFIWMEKNIGLALDQTIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMIILLNQATDIINLWQQSGGNLT 300
            P+  KK  V VK LEKP++VLKF+WM+K+IG+ALD  IPG+GTIPLS Y+FWPRKDAWEELKT LESKPWIS+   + LLNQATDIINLWQ SGG+L+
Sbjct:   86 PLGKKKMRVLVKPLEKPKVVLKFVWMQKDIGVALDHMIPGFGTIPLSPYYFWPRKDAWEELKTLLESKPWISELHRVFLLNQATDIINLWQSSGGDLS 183          
BLAST of CA588029 vs. ExPASy Swiss-Prot
Match: RRP3_HORVU (30S ribosomal protein 3, chloroplastic OS=Hordeum vulgare GN=PSRP3 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.484e-36
Identity = 70/98 (71.43%), Postives = 82/98 (83.67%), Query Frame = 1
Query:   10 VETKKAGVSVKQLEKPRLVLKFIWMEKNIGLALDQTIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMIILLNQATDIINLWQQSGGNLTT 303
            VE+++  V V + + P LVLKFIWMEKNIG+ALDQ +PG G+IPLS Y+FWPRKDAWEEL+  LE K WISQK MIILLNQATDIINLWQQ GG+L+T
Sbjct:   84 VESEEYKVEVPEKQDPMLVLKFIWMEKNIGIALDQMVPGVGSIPLSPYYFWPRKDAWEELRAKLEEKEWISQKQMIILLNQATDIINLWQQGGGSLST 181          
BLAST of CA588029 vs. ExPASy Swiss-Prot
Match: RRP3_CYAP4 (Probable 30S ribosomal protein PSRP-3 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=Cyan7425_0465 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.593e-22
Identity = 46/87 (52.87%), Postives = 63/87 (72.41%), Query Frame = 1
Query:   34 SVKQLEKPRLVLKFIWMEKNIGLALDQTIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMIILLNQATDIINLWQQSGGN 294
            ++ ++   + +LK +W++ N+ LA+DQ + G GT PL+ YFFWPR DAWE+LKT LE K WIS+   I LLN+ATDIIN WQ+ G N
Sbjct:    5 TILEVSLSQFILKVLWLDSNVALAVDQVV-GKGTSPLTSYFFWPRADAWEQLKTELEKKTWISEADRIALLNRATDIINYWQEEGRN 90          
BLAST of CA588029 vs. ExPASy Swiss-Prot
Match: RRP3_PORYE (Probable 30S ribosomal protein 3, chloroplastic OS=Porphyra yezoensis GN=ycf65 PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 3.548e-22
Identity = 47/86 (54.65%), Postives = 62/86 (72.09%), Query Frame = 1
Query:   31 VSVKQLEKPRLVLKFIWMEKNIGLALDQTIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMIILLNQATDIINLWQQSG 288
            + +K L K    LK +W+E NI +A+DQ + G GT PL+ YFFWPR DAWEELK  LESKPWI+++  I LLN+ T++IN WQ+ G
Sbjct:    1 MEIKNLSK--FTLKVLWLENNIAIAIDQIV-GNGTSPLTSYFFWPRNDAWEELKAELESKPWIAERDRIELLNKTTEVINYWQEEG 83          
BLAST of CA588029 vs. ExPASy Swiss-Prot
Match: RRP3_PORPU (Probable 30S ribosomal protein 3, chloroplastic OS=Porphyra purpurea GN=ycf65 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 7.904e-22
Identity = 44/77 (57.14%), Postives = 58/77 (75.32%), Query Frame = 1
Query:   58 RLVLKFIWMEKNIGLALDQTIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMIILLNQATDIINLWQQSG 288
            +  LK +W+E NI +A+DQ + G GT PL+ YFFWPR DAWEELK  LESKPWI+++  I LLN+ T++IN WQ+ G
Sbjct:    3 KFTLKVLWLENNIAIAIDQIV-GNGTSPLTSYFFWPRNDAWEELKAELESKPWIAERDRIELLNKTTEVINYWQEEG 78          
BLAST of CA588029 vs. ExPASy Swiss-Prot
Match: RRP3_THEEB (Probable 30S ribosomal protein PSRP-3 OS=Thermosynechococcus elongatus (strain BP-1) GN=tlr0301 PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.032e-21
Identity = 46/88 (52.27%), Postives = 63/88 (71.59%), Query Frame = 1
Query:   31 VSVKQLEKPRLVLKFIWMEKNIGLALDQTIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMIILLNQATDIINLWQQSGGN 294
            +S ++LE  R  L+ +W+EK++ +A+DQ + G GT PL+ YFFWPR DAWE LK  LE K WI++   I LLN+AT+IIN WQ+ G N
Sbjct:    3 ISFRRLELSRFTLRVLWLEKDVAIAVDQIV-GKGTSPLTSYFFWPRTDAWELLKAELEKKSWITEAERIELLNRATEIINYWQEEGKN 89          
BLAST of CA588029 vs. ExPASy Swiss-Prot
Match: RRP3_ANAVT (Probable 30S ribosomal protein PSRP-3 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_3866 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.348e-21
Identity = 44/79 (55.70%), Postives = 60/79 (75.95%), Query Frame = 1
Query:   58 RLVLKFIWMEKNIGLALDQTIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMIILLNQATDIINLWQQSGGN 294
            + +LK +W+++N+ LA+DQ + G GT PL++YFFWPR DAWEELK  LESK WIS    + LLN+AT++IN WQ+ G N
Sbjct:    3 KFILKILWLDENVALAVDQVV-GKGTSPLTKYFFWPRNDAWEELKKELESKHWISDLDRVELLNKATEVINYWQEEGRN 80          
BLAST of CA588029 vs. ExPASy Swiss-Prot
Match: RRP3_ANASP (Probable 30S ribosomal protein PSRP-3 OS=Anabaena sp. (strain PCC 7120) GN=asr3168 PE=3 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 1.348e-21
Identity = 44/79 (55.70%), Postives = 60/79 (75.95%), Query Frame = 1
Query:   58 RLVLKFIWMEKNIGLALDQTIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMIILLNQATDIINLWQQSGGN 294
            + +LK +W+++N+ LA+DQ + G GT PL++YFFWPR DAWEELK  LESK WIS    + LLN+AT++IN WQ+ G N
Sbjct:    3 KFILKILWLDENVALAVDQVV-GKGTSPLTKYFFWPRNDAWEELKKELESKHWISDLDRVELLNKATEVINYWQEEGRN 80          
The following BLAST results are available for this feature:
BLAST of CA588029 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
RRP3_SPIOL6.876e-4280.6130S ribosomal protein 3, chloroplastic OS=Spinacia... [more]
RRP31_ARATH3.773e-4079.0030S ribosomal protein 3-1, chloroplastic OS=Arabid... [more]
RRP32_ARATH3.904e-3771.4330S ribosomal protein 3-2, chloroplastic OS=Arabid... [more]
RRP3_HORVU1.484e-3671.4330S ribosomal protein 3, chloroplastic OS=Hordeum ... [more]
RRP3_CYAP41.593e-2252.87Probable 30S ribosomal protein PSRP-3 OS=Cyanothec... [more]
RRP3_PORYE3.548e-2254.65Probable 30S ribosomal protein 3, chloroplastic OS... [more]
RRP3_PORPU7.904e-2257.14Probable 30S ribosomal protein 3, chloroplastic OS... [more]
RRP3_THEEB1.032e-2152.27Probable 30S ribosomal protein PSRP-3 OS=Thermosyn... [more]
RRP3_ANAVT1.348e-2155.70Probable 30S ribosomal protein PSRP-3 OS=Anabaena ... [more]
RRP3_ANASP1.348e-2155.70Probable 30S ribosomal protein PSRP-3 OS=Anabaena ... [more]

Pages

back to top
Libraries
Library NameType
Washington navel orange leaf axil budcdna_library
Properties
Property NameValue
Genbank descriptionGS1410 Washington navel orange leaf axil bud Citrus sinensis cDNA clone DD3.2 5 similar to plastid-specific ribosomal protein [Spinacia oleracea] (AF239218), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CA588029 ID=CA588029|Name=CA588029|organism=Citrus sinensis|type=EST|length=475bp
GCAACCCCAGTAGAAACTAAGAAGGCGGGGGTGTCAGTGAAGCAATTGGA
GAAGCCAAGGCTGGTATTGAAGTTTATATGGATGGAGAAGAACATTGGTC
TAGCTCTTGACCAGACGATACCTGGGTATGGCACCATTCCTTTGAGTCAA
TACTTCTTTTGGCCGAGAAAAGATGCATGGGAAGAGCTCAAGACAACTCT
TGAGAGCAAACCCTGGATTTCCCAGAAAATGATGATTATACTTCTAAATC
AGGCCACTGATATTATCAATTTGTGGCAGCAGAGCGGTGGCAATCTTACT
ACTTAGTTGGATGAAAATTCCGGTTTCTCCGTGAGTTCTCATCGTTTTTG
TATTTCAGTTATTGGATTTGATTTGTATAATTGAAACCTTGTTCATATCT
GCATTACATCGGACACGAGTTGGCTCTGTAATTTGGTTGGTGTTGGCAAA
TTTTTTAATTAATGGGCGTAATGAA
back to top