CA588030

Overview
NameCA588030
Unique NameCA588030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length786
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12567 contig Csv1_Contig12567:811..1595. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CA588030 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.498e-62
Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 3
Query:    3 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 362
            PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL
Sbjct:  226 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 345          
BLAST of CA588030 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 6.514e-58
Identity = 110/120 (91.67%), Postives = 116/120 (96.67%), Query Frame = 3
Query:    3 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 362
            PNVMEAKVVVSSCGHDGPFGATGVK L+SIGMI+ VPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNALDG+YVGG+HPELIL
Sbjct:  222 PNVMEAKVVVSSCGHDGPFGATGVKSLRSIGMIDTVPGMKALDMNVAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIHPELIL 341          
BLAST of CA588030 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.026e-55
Identity = 106/120 (88.33%), Postives = 113/120 (94.17%), Query Frame = 3
Query:    3 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 362
            PNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALK+LG PNA+DGT VG + PEL+L
Sbjct:  219 PNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVL 338          
BLAST of CA588030 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 5.341e-52
Identity = 102/120 (85.00%), Postives = 110/120 (91.67%), Query Frame = 3
Query:    3 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 362
            PNVMEAKVVVSSCGHDGPFGATGVKRL+ IGMI  VPGMKALDMN+AED IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DGT    +  EL++
Sbjct:  225 PNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLREELMI 344          
BLAST of CA588030 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 2.030e-51
Identity = 100/109 (91.74%), Postives = 105/109 (96.33%), Query Frame = 3
Query:    3 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGT 329
            PNVMEAKVVVSSCGHDGPFGATGVKRL+ IGMI  VPGMKALDMN+AED IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DGT
Sbjct:  222 PNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGT 330          
BLAST of CA588030 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 8.298e-29
Identity = 63/98 (64.29%), Postives = 79/98 (80.61%), Query Frame = 3
Query:    3 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 296
            PN + A +V+S+ GHD P GA  VKRL S+G IE++ GM+ LDMN AEDAIV+ TRE+VPG+IV GME++E+DGA RMGPTFGAM++SG KAA  ALK
Sbjct:  216 PNTINAPLVISTTGHDAPMGAFCVKRLVSMGRIEKLGGMRGLDMNVAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGLKAAEEALK 313          
BLAST of CA588030 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 2.414e-28
Identity = 61/98 (62.24%), Postives = 78/98 (79.59%), Query Frame = 3
Query:    3 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 296
            PN + A V++S+ GHDGPFGA   KRL S+G ++++ GM+ LDMNSAEDAIV+ TREV  G+I+ GME++EIDG  RMGPTFGAM++SG KAA  ALK
Sbjct:  219 PNTINAPVIISTTGHDGPFGAFCAKRLVSMGSVDKLGGMRGLDMNSAEDAIVKNTREVTKGLIIGGMELSEIDGFNRMGPTFGAMVLSGVKAAEEALK 316          
BLAST of CA588030 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 3.153e-28
Identity = 62/98 (63.27%), Postives = 78/98 (79.59%), Query Frame = 3
Query:    3 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 296
            PN + A +++S+ GHDGP GA  VKRL S+  IE++ GM+ LDMN AEDAIV+ TRE+VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK
Sbjct:  212 PNTINAPLIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALK 309          
BLAST of CA588030 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 7.766e-27
Identity = 63/111 (56.76%), Postives = 77/111 (69.37%), Query Frame = 3
Query:    3 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYV 335
            PN + A +VVS+ GHDGPFGA  VKRL S  ++  +  M+ LDMN AED IV+ TREV PGMIV GME++E DGA RMGPTFG MM SG KAA  AL    +  A++  Y+
Sbjct:  218 PNTINAHLVVSATGHDGPFGAFCVKRLASAQLVSNLHDMRPLDMNRAEDLIVKGTREVFPGMIVGGMELSEFDGANRMGPTFGGMMFSGIKAAQEALAIFDERKAVNEKYL 328          
BLAST of CA588030 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.951e-26
Identity = 59/112 (52.68%), Postives = 80/112 (71.43%), Query Frame = 3
Query:    3 PNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVG 338
            P+ + A +V S  GHDGPFGA  VKR+ S G+ E +  M+ LDM  AED I   TRE++PG+IV GME++E DG+ RMGPTFGAM++SG++AA +AL+SL +    +G  VG
Sbjct:  224 PSTITAPLVCSFAGHDGPFGAFCVKRVASAGLSEGLGDMRPLDMERAEDHIANKTREILPGLIVGGMELSEFDGSARMGPTFGAMLLSGKRAAEVALQSLDRVKIEEGEVVG 335          
The following BLAST results are available for this feature:
BLAST of CA588030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
THI4_CITSI1.498e-62100.00Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL6.514e-5891.67Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH3.026e-5588.33Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE5.341e-5285.00Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE2.030e-5191.74Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI4_FUSSH8.298e-2964.29Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_ASPOR2.414e-2862.24Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]
THI4_FUSOX3.153e-2863.27Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI2_SCHPO7.766e-2756.76Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]
THI4_UROFA2.951e-2652.68Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]

Pages

back to top
Libraries
Library NameType
Washington navel orange leaf axil budcdna_library
Properties
Property NameValue
Genbank descriptionGS1598 Washington navel orange leaf axil bud Citrus sinensis cDNA clone DD15.2(98) 5 similar to thiamin biosynthesis protein thi1 [Citrus sinensis](CAB05370), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CA588030 ID=CA588030|Name=CA588030|organism=Citrus sinensis|type=EST|length=786bp
ATCCCAATGTAATGGAAGCGAAGGTGGTTGTGAGCTCTTGTGGCCATGAT
GGGCCTTTTGGGGCCACTGGAGTAAAGAGGTTGAAGAGTATCGGAATGAT
TGAGGAAGTGCCTGGAATGAAGGCACTGGACATGAACTCTGCAGAAGATG
CTATTGTGAGGCTGACCAGGGAGGTTGTGCCTGGTATGATAGTTACCGGC
ATGGAAGTTGCCGAGATTGATGGTGCTCCTCGAATGGGGCCAACATTTGG
AGCAATGATGATATCGGGGCAGAAGGCTGCGCATTTGGCGTTGAAGTCAC
TGGGCCAGCCGAATGCATTAGACGGTACATATGTGGGAGGCGTTCACCCT
GAGCTGATCTTAGCTGCAGCTGATTCTGCTGAGACTGCTGATGCTTAATT
TGGTAATAACAGGCATCATCACTCATCAGCTGTGTGCATGCAAATAAACT
CTGGCAAAAAAGTAGTTGTATTTAGGTGGTTGTGATGGATGGTTGATGCG
AATAATGAGATAATGTTGTGAGGTTTTGTGAATAAAGTGTTTGTTTCCGG
TCCATCATGGAACCTTTAATTTTAATTTCTTTCTCCTCTTGTAAGAAACC
GTTGTGAGTTTTTCGGAGGTGAATTTGCAGTTGCGTATCTAGTCCTTGTT
ATCTGTGTTATGTGTAGGACTGCCCCTTGGGCTGTTCCCTTTTCCTTGCT
TTGTATGTTTATAACTTGAGGCATCAGCCAATGGGGAAAAGTGCTGATGT
GATTAAAGATCAATGATGAAGATCTGAGCTTACCTC
back to top