CA588032

Overview
NameCA588032
Unique NameCA588032
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length306
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10071 contig Csv1_Contig10071:1042..1347. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CA588032 vs. ExPASy Swiss-Prot
Match: BURP3_ORYSJ (BURP domain-containing protein 3 OS=Oryza sativa subsp. japonica GN=BURP3 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.964e-11
Identity = 26/30 (86.67%), Postives = 30/30 (100.00%), Query Frame = 1
Query:    1 NPKHLAFQVLKVKPGTVPICHFLPEDHIVW 90
            NPKH+AFQVLKVKPGTVP+CHFLP+DH+VW
Sbjct:  396 NPKHVAFQVLKVKPGTVPVCHFLPQDHVVW 425          
The following BLAST results are available for this feature:
BLAST of CA588032 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
BURP3_ORYSJ1.964e-1186.67BURP domain-containing protein 3 OS=Oryza sativa s... [more]
back to top
Libraries
Library NameType
Washington navel orange leaf axil budcdna_library
Properties
Property NameValue
Genbank descriptionGS1417 Washington navel orange leaf axil bud Citrus sinensis cDNA clone DD8.2 5 similar to dehydration-responsive protein RD22 [Prunus persica] (AF319165), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CA588032 ID=CA588032|Name=CA588032|organism=Citrus sinensis|type=EST|length=306bp
AACCCCAAGCATTTAGCTTTTCAAGTGCTCAAAGTTAAGCCAGGAACTGT
TCCTATATGTCACTTCCTTCCTGAGGATCACATTGTCTGGGTTCCCAATA
AGAAGACTGGAGAATAGAATTTGATCCTCTTATCCCATCTACTTAATCAG
CAGAGTTTGAATCAGTCAGTTCAAGCAGTTATCCATTTAGTTGTATAATA
ATTTACTTTGAATACCCAGTTCAATTTGTTATGCATACATTAAGCTTGCT
GTACTTCAAAACTTGTGTGCCTAGTATTTATCTTATCTACTTATGGAGCT
ATCTTC
back to top