CA588033

Overview
NameCA588033
Unique NameCA588033
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length627
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CA588033 vs. ExPASy Swiss-Prot
Match: NEP2_NEPGR (Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.408e-24
Identity = 58/147 (39.46%), Postives = 80/147 (54.42%), Query Frame = 2
Query:  116 SVGADVKETDATTIPAKDGSVVATGDYVVTVGIGTPKKDLSLVFDTGSDLTWTQCEPCLRFCYQQKEPIYDPSASRTYANVSCSSAICDSLESGTGMTPQCAGSTCVYGIEYGDNSFSAGFFAKETLTLTSSDVFPNFLFGCGQYNR 556
            S+ A ++ +     P   G     G+Y++ V IGTP    S + DTGSDL WTQCEPC + C+ Q  PI++P  S +++ + C S  C  L S T     C  + C Y   YGD S + G+ A ET T  +S V PN  FGCG+ N+
Sbjct:   74 SINAMLQSSSGIETPVYAGD----GEYLMNVAIGTPDSSFSAIMDTGSDLIWTQCEPCTQ-CFSQPTPIFNPQDSSSFSTLPCESQYCQDLPSET-----CNNNECQYTYGYGDGSTTQGYMATETFTFETSSV-PNIAFGCGEDNQ 209          
BLAST of CA588033 vs. ExPASy Swiss-Prot
Match: NEP1_NEPGR (Aspartic proteinase nepenthesin-1 OS=Nepenthes gracilis GN=nep1 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.839e-24
Identity = 52/123 (42.28%), Postives = 75/123 (60.98%), Query Frame = 2
Query:  188 GDYVVTVGIGTPKKDLSLVFDTGSDLTWTQCEPCLRFCYQQKEPIYDPSASRTYANVSCSSAICDSLESGTGMTPQCAGSTCVYGIEYGDNSFSAGFFAKETLTLTSSDVFPNFLFGCGQYNR 556
            G+Y++ + IGTP +  S + DTGSDL WTQC+PC + C+ Q  PI++P  S +++ + CSS +C +L S     P C+ + C Y   YGD S + G    ETLT  S  + PN  FGCG+ N+
Sbjct:   93 GEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQPCTQ-CFNQSTPIFNPQGSSSFSTLPCSSQLCQALSS-----PTCSNNFCQYTYGYGDGSETQGSMGTETLTFGSVSI-PNITFGCGENNQ 208          
The following BLAST results are available for this feature:
BLAST of CA588033 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NEP2_NEPGR1.408e-2439.46Aspartic proteinase nepenthesin-2 OS=Nepenthes gra... [more]
NEP1_NEPGR1.839e-2442.28Aspartic proteinase nepenthesin-1 OS=Nepenthes gra... [more]
back to top
Libraries
Library NameType
Washington navel orange leaf axil budcdna_library
Properties
Property NameValue
Genbank descriptionGS1484 Washington navel orange leaf axil bud Citrus sinensis cDNA clone DD16.2 5 similar to cnd41-like protein [Arabidopsis thaliana] (CAB96832), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CA588033 ID=CA588033|Name=CA588033|organism=Citrus sinensis|type=EST|length=627bp
TCCATGTAATAAACTTGATGGAGGCAATGCGAAGTTTCCATCTCAGGCGG
AGATCCTCCAGCAAGACCAATCTCGAGTTAACTCAATTCACTCCAAATCT
AGACTTTCAAAGAACTCAGTCGGCGCCGATGTAAAGGAGACAGACGCCAC
CACGATCCCGGCCAAGGACGGTAGCGTGGTGGCTACTGGGGATTACGTTG
TTACCGTCGGTATCGGCACTCCGAAAAAAGATTTATCGCTTGTGTTTGAC
ACTGGAAGTGACCTTACATGGACGCAGTGTGAGCCTTGCTTGAGGTTTTG
CTACCAACAAAAGGAACCAATATACGACCCATCTGCGTCCAGAACATATG
CCAATGTTTCTTGCTCATCAGCAATATGCGATTCACTCGAGTCCGGCACA
GGTATGACGCCACAATGTGCAGGCTCAACATGTGTTTACGGCATCGAGTA
TGGAGACAACTCATTCTCCGCTGGATTCTTTGCCAAAGAAACCCTAACCC
TGACATCTTCAGATGTTTTCCCCAACTTCCTCTTCGGCTGTGGCCAATAC
AACCGCGGCCTATATGGTCAAGCGGCTGGCTTGCTCGGTCTCGGCCAAGA
CTCGATCTCGTTAGTCTCCCAAACTTC
back to top