CA588035

Overview
NameCA588035
Unique NameCA588035
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length182
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8360 contig Csv1_Contig8360:1146..1327. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CA588035 vs. ExPASy Swiss-Prot
Match: LIP1_ARATH (Triacylglycerol lipase 1 OS=Arabidopsis thaliana GN=LIP1 PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.327e-11
Identity = 29/46 (63.04%), Postives = 38/46 (82.61%), Query Frame = 1
Query:    1 VIDVQHTLNELQSTPELVYLENYGHMDFILSINGKEDLYNNMIGFF 138
            V DV+HTL EL S+PEL+YLE+YGH+DF+L  + KED+Y +MI FF
Sbjct:  339 VTDVEHTLAELPSSPELLYLEDYGHIDFVLGSSAKEDVYKHMIQFF 384          
The following BLAST results are available for this feature:
BLAST of CA588035 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
LIP1_ARATH4.327e-1163.04Triacylglycerol lipase 1 OS=Arabidopsis thaliana G... [more]
back to top
Libraries
Library NameType
Washington navel orange leaf axil budcdna_library
Properties
Property NameValue
Genbank descriptionGS1488 Washington navel orange leaf axil bud Citrus sinensis cDNA clone DD22.2 similar to lysosomal acid lipase[Arabidopsis thaliana] (AAD25569), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CA588035 ID=CA588035|Name=CA588035|organism=Citrus sinensis|type=EST|length=182bp
GTGATAGATGTGCAGCACACTCTCAATGAGTTGCAGTCCACTCCGGAGTT
GGTTTATCTTGAGAACTACGGTCATATGGACTTTATTTTGAGCATAAATG
GGAAGGAAGATCTTTACAACAATATGATTGGATTTTTCAGTTCTTTGGGA
AAGTCTAGCAGCTCTTGATGGGAGTGCTTTTG
back to top