CA588037

Overview
NameCA588037
Unique NameCA588037
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length474
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6332 contig Csv1_Contig6332:845..1317. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CA588037 vs. ExPASy Swiss-Prot
Match: LOX23_HORVU (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare GN=LOX2.3 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.631e-17
Identity = 41/64 (64.06%), Postives = 52/64 (81.25%), Query Frame = 1
Query:    7 DPVIKAAFEEFNLKMQELERIIDDRNSNENLKNRTGAAIVPYELLKPFSEPGATGKGVPYSISI 198
            +P++KAAFE+F+ +++E E  ID RN+N   KNR GA IVPYELLKPFSEPG TG+G+P SISI
Sbjct:  833 EPMVKAAFEKFSGRLKEAEGTIDMRNNNPENKNRCGAGIVPYELLKPFSEPGVTGRGIPNSISI 896          
BLAST of CA588037 vs. ExPASy Swiss-Prot
Match: LOX2_ARATH (Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana GN=LOX2 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 7.655e-17
Identity = 43/65 (66.15%), Postives = 49/65 (75.38%), Query Frame = 1
Query:    4 DDPVIKAAFEEFNLKMQELERIIDDRNSNENLKNRTGAAIVPYELLKPFSEPGATGKGVPYSISI 198
            ++PVI AAFE F  K+Q LE +ID+RN N  LKNR GA +V YELLKP SE G TG GVPYSISI
Sbjct:  832 NEPVINAAFERFKGKLQYLEGVIDERNVNITLKNRAGAGVVKYELLKPTSEHGVTGMGVPYSISI 896          
BLAST of CA588037 vs. ExPASy Swiss-Prot
Match: LOXC1_ORYSJ (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX1 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 2.305e-13
Identity = 32/64 (50.00%), Postives = 47/64 (73.44%), Query Frame = 1
Query:    7 DPVIKAAFEEFNLKMQELERIIDDRNSNENLKNRTGAAIVPYELLKPFSEPGATGKGVPYSISI 198
            D  ++AA++ F  +++E+E +ID RN +  LKNR GA I+PY+L+KPFS+ G TG G+P S SI
Sbjct:  861 DAAVQAAYDGFAARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDSGVTGMGIPNSTSI 924          
BLAST of CA588037 vs. ExPASy Swiss-Prot
Match: LOXC2_ORYSJ (Probable lipoxygenase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX2 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.010e-13
Identity = 32/64 (50.00%), Postives = 46/64 (71.88%), Query Frame = 1
Query:    7 DPVIKAAFEEFNLKMQELERIIDDRNSNENLKNRTGAAIVPYELLKPFSEPGATGKGVPYSISI 198
            D  ++AA+  F  +++E+E +ID RN +  LKNR GA I+PY+L+KPFS+ G TG G+P S SI
Sbjct:  878 DAAVQAAYAGFTARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDAGVTGMGIPNSTSI 941          
BLAST of CA588037 vs. ExPASy Swiss-Prot
Match: LOX1_ARATH (Lipoxygenase 1 OS=Arabidopsis thaliana GN=LOX1 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.328e-12
Identity = 33/58 (56.90%), Postives = 44/58 (75.86%), Query Frame = 1
Query:   25 AFEEFNLKMQELERIIDDRNSNENLKNRTGAAIVPYELLKPFSEPGATGKGVPYSISI 198
            AFE+F  K++E+E+ ID+RN +E LKNRTG   +PY LL P SE G TG+G+P S+SI
Sbjct:  802 AFEKFGEKVKEIEKNIDERNDDETLKNRTGLVKMPYTLLFPSSEGGVTGRGIPNSVSI 859          
BLAST of CA588037 vs. ExPASy Swiss-Prot
Match: LOX6_ARATH (Lipoxygenase 6, choloroplastic OS=Arabidopsis thaliana GN=LOX6 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 8.198e-11
Identity = 32/65 (49.23%), Postives = 48/65 (73.85%), Query Frame = 1
Query:    4 DDPVIKAAFEEFNLKMQELERIIDDRNSNENLKNRTGAAIVPYELLKPFSEPGATGKGVPYSISI 198
            D+ V+K  F +F+ ++ ++E+ I++RN ++ LKNRTGA + PYELL P S  G TG+G+P SISI
Sbjct:  854 DEQVVKY-FNKFSEELVKIEKTINERNKDKKLKNRTGAGMPPYELLLPTSPHGVTGRGIPNSISI 917          
The following BLAST results are available for this feature:
BLAST of CA588037 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
LOX23_HORVU2.631e-1764.06Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare... [more]
LOX2_ARATH7.655e-1766.15Lipoxygenase 2, chloroplastic OS=Arabidopsis thali... [more]
LOXC1_ORYSJ2.305e-1350.00Lipoxygenase 7, chloroplastic OS=Oryza sativa subs... [more]
LOXC2_ORYSJ3.010e-1350.00Probable lipoxygenase 8, chloroplastic OS=Oryza sa... [more]
LOX1_ARATH3.328e-1256.90Lipoxygenase 1 OS=Arabidopsis thaliana GN=LOX1 PE=... [more]
LOX6_ARATH8.198e-1149.23Lipoxygenase 6, choloroplastic OS=Arabidopsis thal... [more]
back to top
Libraries
Library NameType
Washington navel orange leaf axil budcdna_library
Properties
Property NameValue
Genbank descriptionGS1485 Washington navel orange leaf axil bud Citrus sinensis cDNA clone DD17.2 5 similar to loxc homologue [Lycopersicon esculentum] (CAA05280), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CA588037 ID=CA588037|Name=CA588037|organism=Citrus sinensis|type=EST|length=474bp
GGTGATGACCCAGTTATAAAGGCTGCATTTGAAGAGTTTAACCTCAAAAT
GCAGGAGCTTGAAAGGATCATTGATGACAGAAATTCGAATGAGAATTTGA
AGAACAGAACTGGAGCTGCGATTGTTCCATATGAGCTCCTGAAGCCGTTT
TCGGAACCTGGCGCGACAGGAAAAGGAGTTCCCTACAGCATCTCCATCTA
GAGTGCACGAAGTTCATTGCAAATCAAACTTTAAGAAATAAGATGTCATA
CGTCTTTAATTTAAATAAGCTGCTTCGCCGGAATTTTTTCCGGCTAGCCA
AATACCAAAACTACCAATGAGCTCATTACACGGTTTTGGTCGTTGATGTT
TGTACTTTATGTTGCGTGGGAGTGGGTCCTAGGAGTCACTTCTAGAATAA
ATTGTTTGTAGCTCTGTGAGTATATGATGTGATATAATGTTATGTTTTCT
TTATCAAGAATAAATCTTCTTCAA
back to top