CB250244

Overview
NameCB250244
Unique NameCB250244
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length710
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2173 contig Csv1_Contig2173:102..811. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250244 vs. ExPASy Swiss-Prot
Match: LGUL_CICAR (Lactoylglutathione lyase OS=Cicer arietinum PE=2 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 7.161e-90
Identity = 152/181 (83.98%), Postives = 165/181 (91.16%), Query Frame = 1
Query:   13 MASSEPKESPANNPGLHTARDEATNGYFMQQTMFRIKDPKVSLDFYSRMLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKAYERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTIGKI 555
            MA+SE KESPANNPGLHT  DEAT GYFMQQTMFRIKDPKVSLDFYSR+LGMSLLKRLDFPEMKFSLYF+GYEDT  AP++PVDRTVWTF + ATIELTHNWGTESDP+FKGYHNGNS+PRGFGHIGITVDD YKA ERF+ LGVEF KKPD GK+KG+AFIKDPD YWIE+FD KTIG +
Sbjct:    1 MAASESKESPANNPGLHTTIDEATKGYFMQQTMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDTTEAPSNPVDRTVWTFAQKATIELTHNWGTESDPEFKGYHNGNSDPRGFGHIGITVDDTYKACERFQNLGVEFVKKPDDGKMKGIAFIKDPDGYWIELFDRKTIGNV 181          
BLAST of CB250244 vs. ExPASy Swiss-Prot
Match: LGUL_BRAJU (Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.764e-88
Identity = 150/182 (82.42%), Postives = 164/182 (90.11%), Query Frame = 1
Query:   19 SSEPKESPANNPGLHTARDEATNGYFMQQTMFRIKDPKVSLDFYSRMLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKAYERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTIGKIGGS 564
            +SE KESPANNPGL T RDEAT GY MQQTMFR+KDPK SLDFYSR+LGMSLLKRLDF EMKFSLYFLGYEDT++AP DP +RTVWTFG+PATIELTHNWGTESDP+FKGYHNGNSEPRGFGHIG+TVDDV+KA ERFE+LGVEF KKP  GK+K +AFIKDPD YWIEIFDLKTIG   G+
Sbjct:    2 ASEAKESPANNPGLSTVRDEATKGYIMQQTMFRVKDPKASLDFYSRVLGMSLLKRLDFSEMKFSLYFLGYEDTSTAPTDPTERTVWTFGRPATIELTHNWGTESDPEFKGYHNGNSEPRGFGHIGVTVDDVHKACERFEQLGVEFVKKPHDGKMKNIAFIKDPDGYWIEIFDLKTIGTTAGN 183          
BLAST of CB250244 vs. ExPASy Swiss-Prot
Match: LGUL_ARATH (Lactoylglutathione lyase OS=Arabidopsis thaliana GN=At1g08110 PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 8.754e-88
Identity = 150/177 (84.75%), Postives = 162/177 (91.53%), Query Frame = 1
Query:   19 SSEPKESPANNPGLHTARDEATNGYFMQQTMFRIKDPKVSLDFYSRMLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKAYERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTIG 549
            +SE +ESPANNPGL T RDEAT GY MQQTMFRIKDPK SLDFYSR+LGMSLLKRLDF EMKFSLYFLGYEDT +AP DP +RTVWTFG+PATIELTHNWGTESDP+FKGYHNGNSEPRGFGHIG+TVDDV+KA ERFE LGVEFAKKP+ GK+K +AFIKDPD YWIEIFDLKTIG
Sbjct:    2 ASEARESPANNPGLSTNRDEATKGYIMQQTMFRIKDPKASLDFYSRVLGMSLLKRLDFSEMKFSLYFLGYEDTTTAPTDPTERTVWTFGQPATIELTHNWGTESDPEFKGYHNGNSEPRGFGHIGVTVDDVHKACERFEELGVEFAKKPNDGKMKNIAFIKDPDGYWIEIFDLKTIG 178          
BLAST of CB250244 vs. ExPASy Swiss-Prot
Match: LGUL_SOYBN (Lactoylglutathione lyase OS=Glycine max GN=GLXI PE=1 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.547e-87
Identity = 145/179 (81.01%), Postives = 163/179 (91.06%), Query Frame = 1
Query:   19 SSEPKESPANNPGLHTARDEATNGYFMQQTMFRIKDPKVSLDFYSRMLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKAYERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTIGKI 555
            ++EPKESP+NNPGLHT  DEAT GY MQQTMFRIKDPKVSLDFYSR+LGMSLLKRLDFPEMKFSLYF+GYE+TA AP++P+D+ VWTF + ATIELTHNWGTESDP+FKGYHNGNSEPRGFGHIG+TVDD YKA ERF+ LGVEF KKP+ GK+KG+AFIKDPD YWIEIFD KTIG +
Sbjct:    2 AAEPKESPSNNPGLHTTPDEATKGYIMQQTMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYENTAEAPSNPIDKVVWTFSQKATIELTHNWGTESDPEFKGYHNGNSEPRGFGHIGVTVDDTYKACERFQNLGVEFVKKPEDGKMKGIAFIKDPDGYWIEIFDRKTIGNV 180          
BLAST of CB250244 vs. ExPASy Swiss-Prot
Match: LGUL_SOLLC (Lactoylglutathione lyase OS=Solanum lycopersicum GN=GLX1 PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 9.059e-85
Identity = 144/182 (79.12%), Postives = 161/182 (88.46%), Query Frame = 1
Query:   19 SSEPKESPANNPGLHTARDEATNGYFMQQTMFRIKDPKVSLDFYSRMLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKAYERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTIGKIGGS 564
            +SE K+SP+NNPGLH   DEAT GYF+QQTMFRIKDPKVSL+FYS++LGMSLLKRLDFPEMKFSLYF+GYEDTASAP+DPV+RT WTF + +T+ELTHNWGTESDP+F GYHNGNSEPRGFGHIG+TVDDVYKA ERFE LGVEF KKP  GK+KG+AFIKDPD YWIEIFD K I    GS
Sbjct:    2 ASESKDSPSNNPGLHATPDEATKGYFLQQTMFRIKDPKVSLEFYSKVLGMSLLKRLDFPEMKFSLYFMGYEDTASAPSDPVERTAWTFSQKSTLELTHNWGTESDPNFTGYHNGNSEPRGFGHIGVTVDDVYKACERFESLGVEFVKKPLDGKMKGIAFIKDPDGYWIEIFDTKIIKDAAGS 183          
BLAST of CB250244 vs. ExPASy Swiss-Prot
Match: LGUL_MOUSE (Lactoylglutathione lyase OS=Mus musculus GN=Glo1 PE=1 SV=3)

HSP 1 Score: 223.402 bits (568), Expect = 9.440e-58
Identity = 103/161 (63.98%), Postives = 125/161 (77.64%), Query Frame = 1
Query:   73 DEATNGYFMQQTMFRIKDPKVSLDFYSRMLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKAYERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTIGKI 555
            D +T  + +QQTM RIKDPK SLDFY+R+LG++LL++LDFP MKFSLYFL YED    P D  ++T WTF + AT+ELTHNWGTE D + + YHNGNS+PRGFGHIGI V DVY A +RFE LGV+F KKPD GK+KG+AFI+DPD YWIEI +   I  I
Sbjct:   24 DPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDD-ETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKIATI 183          
BLAST of CB250244 vs. ExPASy Swiss-Prot
Match: LGUL_RAT (Lactoylglutathione lyase OS=Rattus norvegicus GN=Glo1 PE=1 SV=3)

HSP 1 Score: 222.631 bits (566), Expect = 1.610e-57
Identity = 100/154 (64.94%), Postives = 123/154 (79.87%), Query Frame = 1
Query:   73 DEATNGYFMQQTMFRIKDPKVSLDFYSRMLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKAYERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFD 534
            D +T  + +QQTM RIKDPK SLDFY+R+LG++LL++LDFP MKFSLYFL YED    P D  +RT W F + AT+ELTHNWGTE D + + YHNGNS+PRGFGHIGI V DVY+A +RFE LGV+F KKPD GK+KG+AF++DPD YWIEI +
Sbjct:   24 DPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPSMKFSLYFLAYEDKNDIPKDKTERTAWAFSRKATLELTHNWGTEDD-ETQSYHNGNSDPRGFGHIGIAVPDVYEACKRFEELGVKFVKKPDDGKMKGLAFVQDPDGYWIEILN 176          
BLAST of CB250244 vs. ExPASy Swiss-Prot
Match: LGUL_MACFA (Lactoylglutathione lyase OS=Macaca fascicularis GN=GLO1 PE=2 SV=3)

HSP 1 Score: 211.846 bits (538), Expect = 2.842e-54
Identity = 95/154 (61.69%), Postives = 119/154 (77.27%), Query Frame = 1
Query:   73 DEATNGYFMQQTMFRIKDPKVSLDFYSRMLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKAYERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFD 534
            D +T  + +QQTM R+KDPK SLDFY+R+LGM+L+++ DFP MKFSLYFL YED    P D  ++  W   + AT+ELTHNWGTE D + + YHNGNS+PRGFGHIGI V DV+ A +RFE LGV+F KKPD GK+KG+AFI+DPD YWIEI +
Sbjct:   24 DPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPAMKFSLYFLAYEDKNDIPKDKEEKIAWALSRKATLELTHNWGTEDD-ETQSYHNGNSDPRGFGHIGIAVPDVHSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILN 176          
BLAST of CB250244 vs. ExPASy Swiss-Prot
Match: LGUL_HUMAN (Lactoylglutathione lyase OS=Homo sapiens GN=GLO1 PE=1 SV=4)

HSP 1 Score: 211.075 bits (536), Expect = 4.848e-54
Identity = 95/154 (61.69%), Postives = 119/154 (77.27%), Query Frame = 1
Query:   73 DEATNGYFMQQTMFRIKDPKVSLDFYSRMLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKAYERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFD 534
            D +T  + +QQTM R+KDPK SLDFY+R+LGM+L+++ DFP MKFSLYFL YED    P +  ++  W   + AT+ELTHNWGTE D + + YHNGNS+PRGFGHIGI V DVY A +RFE LGV+F KKPD GK+KG+AFI+DPD YWIEI +
Sbjct:   24 DPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDD-ETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILN 176          
BLAST of CB250244 vs. ExPASy Swiss-Prot
Match: LGUL_PSEAE (Lactoylglutathione lyase OS=Pseudomonas aeruginosa GN=gloA PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.850e-43
Identity = 90/169 (53.25%), Postives = 108/169 (63.91%), Query Frame = 1
Query:   52 PGLHTARDEATNGYFMQQTMFRIKDPKVSLDFYSRMLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELTHNWGTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKAYERFERLGVEFAKKPDGGKLKGVAFIKDPDDYWIEIFDLKTIGKIG 558
            PG+    D  T  Y    TM R+KDPK SLDFYSR+LGM LL+RLDF E +FSLYFL        P    +R  +TFG+ + +ELTHNWG+ESD     YHNGN +PRGFGHI  +V D+  A ERFE LGV F K  D G +K VAFI DPD YW+EI      G++G
Sbjct:    9 PGICMEPDAITQEYVFNHTMLRVKDPKRSLDFYSRVLGMRLLRRLDFEEGRFSLYFLAMTRGEEVPDAVDERQRYTFGRQSVLELTHNWGSESDD--SQYHNGNQDPRGFGHICFSVPDLVAACERFETLGVNFVKPLDRG-MKNVAFISDPDGYWVEIVQASLNGEMG 174          
The following BLAST results are available for this feature:
BLAST of CB250244 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
LGUL_CICAR7.161e-9083.98Lactoylglutathione lyase OS=Cicer arietinum PE=2 S... [more]
LGUL_BRAJU1.764e-8882.42Lactoylglutathione lyase OS=Brassica juncea GN=GLY... [more]
LGUL_ARATH8.754e-8884.75Lactoylglutathione lyase OS=Arabidopsis thaliana G... [more]
LGUL_SOYBN2.547e-8781.01Lactoylglutathione lyase OS=Glycine max GN=GLXI PE... [more]
LGUL_SOLLC9.059e-8579.12Lactoylglutathione lyase OS=Solanum lycopersicum G... [more]
LGUL_MOUSE9.440e-5863.98Lactoylglutathione lyase OS=Mus musculus GN=Glo1 P... [more]
LGUL_RAT1.610e-5764.94Lactoylglutathione lyase OS=Rattus norvegicus GN=G... [more]
LGUL_MACFA2.842e-5461.69Lactoylglutathione lyase OS=Macaca fascicularis GN... [more]
LGUL_HUMAN4.848e-5461.69Lactoylglutathione lyase OS=Homo sapiens GN=GLO1 P... [more]
LGUL_PSEAE3.850e-4353.25Lactoylglutathione lyase OS=Pseudomonas aeruginosa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0006 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ006 similar to lactolylglutathione lyase (acc# O49818), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250244 ID=CB250244|Name=CB250244|organism=Citrus sinensis|type=EST|length=710bp
CGGTTGCTTTCAATGGCTTCTTCGGAGCCCAAAGAATCGCCCGCTAACAA
TCCGGGTCTTCACACCGCCCGTGATGAAGCTACCAACGGATACTTCATGC
AACAAACGATGTTTCGAATTAAGGACCCCAAAGTTAGTCTTGATTTCTAT
TCTCGTATGTTGGGCATGTCGCTACTAAAGAGGTTGGATTTTCCAGAAAT
GAAATTTAGCCTATACTTTTTGGGCTATGAGGATACTGCATCAGCTCCAG
CTGACCCTGTTGATAGAACTGTTTGGACTTTTGGGAAGCCAGCTACAATT
GAGCTGACTCATAACTGGGGAACTGAAAGTGATCCCGACTTCAAAGGTTA
TCACAATGGGAATTCAGAACCCCGTGGCTTTGGGCACATCGGCATCACTG
TTGATGATGTATATAAGGCATATGAGAGGTTTGAACGTCTAGGAGTGGAA
TTTGCAAAGAAACCAGATGGTGGAAAATTGAAAGGCGTAGCATTCATTAA
AGACCCTGATGACTATTGGATTGAAATCTTTGACCTCAAAACAATTGGAA
AAATTGGTGGTAGCACTTGATATGACATTGCACACTCAGGGAAGGCGGGA
TCCATTCATTGTAGTGTTTGATAAATTCTCTGTTGAATAGAACGTCTTCC
ATGAGACGCATTATGGACTGAAATACGATCGCAAATATGTTTCAAACTCC
GAAAGACTTG
back to top